Share this post on:

Name :
Human Siglec3/CD33 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
Myeloid cell surface antigen CD33, also known as GP67 and SIGLEC-3, is a single-pass type I transmembrane protein belonging to the sialic acid binding Ig-like lectin (SIGLEC) family in the immunoglobulin superfamily (IgSF). SIGLECs are characterized by an N-terminal Ig-like V-type domain that mediates sialic acid binding, followed by varying numbers (2 to 17) of Ig-like C2-type domains, a transmembrane region, and a cytoplasmic tail with intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIM). They can be classified into two subgroups: SIGLEC-1, -2, and -4 subgroup, and a SIGLEC-3/CD33-related subgroup (SIGLEC-3, and -5 through -13), defined by sequence similarity and clustered gene localization. SIGLECs are widely expressed on hematopoietic cells, often in a cell-type-specific manner. CD33/SIGLEC-3 contains 1 Ig-like C2-type and 1 Ig-like V-type domains. CD33/SIGLEC-3 expression is restricted to cells of monocytic/myeloid lineage. It is a putative adhesion molecule that preferentially binds sialic acid with α2,6­ linkage. CD33/SIGLEC-3 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatases. When co­crosslinking with FcγR1, CD33/SIGLEC-3 inhibits tyrosine phosphorylation and calcium mobilization. CD33/SIGLEC-3 can also induce apoptosis in acute myeloid leukemia (AML) cells.

Gene Symbol :
The recombinant human CD33-Fc is expressed as a 471 amino acid protein consisting of Asp18 – Gly260 region of CD33 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
945

Uniprot Entry :
P20138

Construct Details :
The recombinant human CD33-Fc is expressed as a 471 amino acid protein consisting of Asp18 – Gly260 region of CD33 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing human CD33-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISR DSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRME RGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGT PPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTER TIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK

M.W. :
Calculated molecular mass (kDa): 52.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 (probably due to glycosylation)

Calculated PI :
7.97

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 68590

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized protein supports the adhesion of human red blood cells. Binds anti-CD33/SIGLEC-3 monoclonal antibody, human IgG1 (SKU#MAB0133) with high affinity (KD

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD33; SIGLEC3; SIGLEC-3; GP67; P67

Research Area :
Hematology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD33

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF basic/bFGF Protein
Chk1 Protein
Popular categories:
IL-36β
Frizzled-4/CD344

Share this post on: