Name :
Human Siglec3/CD33 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
Myeloid cell surface antigen CD33, also known as GP67 and SIGLEC-3, is a single-pass type I transmembrane protein belonging to the sialic acid binding Ig-like lectin (SIGLEC) family in the immunoglobulin superfamily (IgSF). SIGLECs are characterized by an N-terminal Ig-like V-type domain that mediates sialic acid binding, followed by varying numbers (2 to 17) of Ig-like C2-type domains, a transmembrane region, and a cytoplasmic tail with intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIM). They can be classified into two subgroups: SIGLEC-1, -2, and -4 subgroup, and a SIGLEC-3/CD33-related subgroup (SIGLEC-3, and -5 through -13), defined by sequence similarity and clustered gene localization. SIGLECs are widely expressed on hematopoietic cells, often in a cell-type-specific manner. CD33/SIGLEC-3 contains 1 Ig-like C2-type and 1 Ig-like V-type domains. CD33/SIGLEC-3 expression is restricted to cells of monocytic/myeloid lineage. It is a putative adhesion molecule that preferentially binds sialic acid with α2,6 linkage. CD33/SIGLEC-3 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatases. When cocrosslinking with FcγR1, CD33/SIGLEC-3 inhibits tyrosine phosphorylation and calcium mobilization. CD33/SIGLEC-3 can also induce apoptosis in acute myeloid leukemia (AML) cells.
Gene Symbol :
The recombinant human CD33-Fc is expressed as a 471 amino acid protein consisting of Asp18 – Gly260 region of CD33 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
945
Uniprot Entry :
P20138
Construct Details :
The recombinant human CD33-Fc is expressed as a 471 amino acid protein consisting of Asp18 – Gly260 region of CD33 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing human CD33-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISR DSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRME RGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGT PPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTER TIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
M.W. :
Calculated molecular mass (kDa): 52.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 (probably due to glycosylation)
Calculated PI :
7.97
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 68590
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized protein supports the adhesion of human red blood cells. Binds anti-CD33/SIGLEC-3 monoclonal antibody, human IgG1 (SKU#MAB0133) with high affinity (KD
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD33; SIGLEC3; SIGLEC-3; GP67; P67
Research Area :
Hematology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD33
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF basic/bFGF Protein
Chk1 Protein
Popular categories:
IL-36β
Frizzled-4/CD344