Name :
Human IL1RL1/ST2 Protein, ECD (Extracellular Domain), Biotinylated, Recombinant
Description :
IL1RL1 (interleukin 1 receptor-like 1), also known as ST2, DER4, IL1R4 and IL33R, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RL1 can be induced by proinflammatory stimuli, and is involved in the function of helper T (Th) cells. IL1RL1, IL1R1, IL1R2 and IL1RL2 form a cytokine receptor gene cluster in chromosome 2q12. IL1RL1 is expressed on mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It was identified as the receptor for IL33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL1RL1 may promote mast cell and Th2 dependent inflammation, enhance antigen-induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. IL1RL1 has been used as a marker for the diagnosis and prognosis of cardiovascular diseases. Mutations in the IL1RL1 gene are associated with blood eosinophil counts and with asthma. A soluble IL1RL1 isoform is released by activated Th2 cells and is elevated in the serum in allergic asthma. Soluble IL1RL1 may function as a decoy receptor that blocks IL33/IL1RL1-mediated signaling activity.
Gene Symbol :
IL1RL1; ST2; IL1R4; T1; DER4; ST2L; ST2V; FIT-1; IL33R
NCBI Gene ID :
9173
Uniprot Entry :
Q01638
Construct Details :
The recombinant human IL1RL1 ECD is expressed as a 320 amino acid protein consisting of Lys19 Ser328 region of IL1RL1/ST2 (UniProt accession #Q01638) and a C-terminal His-tag.
Source :
Human cells stably expressing human IL1RL1 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFL PAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIY CPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENG ANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFL AAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDC LALNLHGLRRHTVRLSRKNPIDHHSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 (probably due to glycosylation).
Calculated PI :
8.28
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 48985
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized IL1RL1 binds human IL33 in a functional ELISA. Blocks IL33-dependent signaling activity in helper T cells.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
ST2; IL1R4; T1; DER4; ST2L; ST2V; FIT-1; IL33R
Research Area :
Immunology
Pathway/Disease :
IL33 Signaling Pathway
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AARSD1 Protein
USP46 Protein
Popular categories:
Activin AB
IL-5 Receptor α