Name :
Human NECL5 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
NECL5 (Nectin-like protein 5), also known as PVR (poliovirus receptor) and CD155, is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL5 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL5 is predominately expressed in enterocytes and gastrointestinal lymphatic tissues. It was originally identified by the ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. The normal cellular function of NECL5 maybe the involvement of intercellular adhension between epithelial, endothelial, and immune cells. NECL5 interact with CD226 and CD96, which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. Enhanced NECL5 expression in tumor cells contributes to loss of contact inhibition and increased migration. It also allows tumor cell recognition and killing by CD226 or CD96expressing NK cells. NECL5 also binds the inhibitory ligand TIGIT (T-cell immunoreceptor with Ig and ITIM domains) on NK and some mature T cells, antagonizing CD226 effects.
Gene Symbol :
The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 – Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
5817
Uniprot Entry :
P15151
Construct Details :
The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 – Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human NECL5-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESK RLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEP VPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEK PQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 60.7; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
Calculated PI :
6.26
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 86580
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized NECL5 interacts with CD226 (SKU#FCL1028) in a functional ELISA
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
NECL5; CD155; PVR; PVS; HVED; NECL-5; TAGE4; Necl-5
Research Area :
Cancer
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD155
References :
1. J. Biol. Chem. 278:31251 (2003). 2. J. Exp. Med. 199:1331 (2004). 3. Eur. J. Immunol. 37 :2214 (2007). 4. Proc. Natl. Acad. Sci. 106:17858 (2009). 5. J. Immunol. 184:902 (2010).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 beta Protein
IFN-gamma Protein
Popular categories:
B7-DC/CD273
CD74
