Name :
Human IL1RAP Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
IL1RAP (interleukin-1 receptor accessory protein), also known as IL1R3 (interleukin-1 receptor 3), is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin-1 receptor (IL1R) family. Like other family members, IL1RAP contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RAP is identified as a co-receptor for a high-affinity IL-1 receptor type I (IL1R1) complex that mediates IL1-dependent activation of NF-κB, MAPK and other signaling pathways. IL1RAP is required for transducing the signaling events on the plasma membrane level to downstream activation of IL1-responsive genes. IL1 are pleiotropic cytokines that induce synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress. Alternative splicing of the IL1RAP gene results in 2 transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. The soluble form of IL1RAP contributes to the antagonism of IL-1 action. When present with soluble IL1R2, soluble IL1RAP increases the IL1 binding affinity y of IL1R2 more than 100fold. In addition, ILRAP interacts with ST2 on mast cells and Th2 T lymphocytes to create a functional receptor complex for transducing IL33-dependent signaling activity.
Gene Symbol :
The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 – Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
3556
Uniprot Entry :
Q9NPH3
Construct Details :
The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 – Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human IL1RAP-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
Calculated PI :
6.93
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 98750
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 – 2.5 µg/ml.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
IL-1RAP; IL1R3; IL-1R3; IL-1R-3; C3orf13; IL-1RAcP
Research Area :
Immunology
Pathway/Disease :
IL1R/TLR Signaling Pathway
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CAPN1 Protein
ENSA Protein
Popular categories:
CD85c/LIR-8
VEGF-D
