Name :
Ccl11 (Mouse) Recombinant Protein
Biological Activity :
Mouse Ccl11 (P48298, 24 a.a. – 97 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P48298
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=20292
Amino Acid Sequence :
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Molecular Weight :
8
Storage and Stability :
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ion exchange column and HPLC reverse phase column
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Ccl11
Gene Alias :
Scya11, eotaxin
Gene Description :
chemokine (C-C motif) ligand 11
Gene Summary :
Other Designations :
OTTMUSP00000000791|small chemokine (C-C motif) ligand 11|small inducible cytokine A11
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin Family Recombinant Proteins
IL-3 ProteinBiological Activity
Popular categories:
Carbonic Anhydrase 5B (CA-VB)
CD85f/LILRA5
