Name :
Tnfsf10 (Mouse) Recombinant Protein
Biological Activity :
Mouse Tnfsf10 (P50592, 119 a.a. – 291 a.a.) partial recombinant protein expressed with an N-terminal Gly in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P50592
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=22035
Amino Acid Sequence :
RGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Molecular Weight :
20
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water up to 100 ug/mL
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Tnfsf10
Gene Alias :
A330042I21Rik, AI448571, APO-2L, Ly81, TL2, Trail
Gene Description :
tumor necrosis factor (ligand) superfamily, member 10
Gene Summary :
O
Other Designations :
TNF-related apoptosis inducing ligand|TRAIL/APO2L
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TrkA Proteincustom synthesis
IL-10 ProteinSource
Popular categories:
B7-H4
Flk-1/CD309
