Name :
EREG (Human) Recombinant Protein
Biological Activity :
Human EREG (O14944, 63 a.a. – 108 a.a.) partial recombinant protein with hIgG-His tag expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Result of activity analysis
Protein Accession No. :
O14944
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2069
Amino Acid Sequence :
DGSMVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Molecular Weight :
32.6
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (HEK 293) expression system
Purification :
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of EREG (Human) Recombinant Protein.
Storage Buffer :
In PBS, pH 7.4 (10% glycerol)
Applications :
Functional Study， SDS-PAGE，
Gene Name :
EREG
Gene Alias :
ER
Gene Description :
epiregulin
Gene Summary :
Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. [provided by RefSeq
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-beta ProteinGene ID
CD3e MedChemExpress
Popular categories:
CD11a/LFA-1
KIR2DS2
