Name :
Il25 (Mouse) Recombinant protein
Biological Activity :
Mouse Il25 (Q8VHH8) recombinant protein expressed in Escherichia Coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q8VHH8
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=140806
Amino Acid Sequence :
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL_x005f
_x005f
YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV_x005f
_x005f
CVRPRVMA.
Molecular Weight :
35.5
Storage and Stability :
Lyophilized although stable at room temperature for 3 weeks. should be stored desiccated below -20°C. Upon reconstitution should be stored at 4°C between 2-7 days and for future use below -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from with no additives
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Il25
Gene Alias :
IL-17E, Il17e
Gene Description :
interleukin 25
Gene Summary :
Other Designations :
interleukin 17E
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Hemopexin Proteincustom synthesis
M-CSF site
Popular categories:
Ubiquitin-Specific Peptidase 15
IL-17 Receptor
