Name :
IGSF11 (Human) Recombinant Protein
Biological Activity :
Human IGSF11 (Q5DX21-1, 23 a.a. – 241 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Result of bioactivity analysis
Protein Accession No. :
Q5DX21-1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=152404
Amino Acid Sequence :
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
Molecular Weight :
24.31
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purification :
Quality Control Testing :
SEC-HPLC and Tris-Bis PAGE SEC-HPLC The purity of Human IGSF11 is greater than 95% as determined by SEC-HPLC. Tris-Bis PAGE Human IGSF11 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Functional Study， SDS-PAGE， Surface Plasmon Resonance， Human B7-H5, hFc Tag captured on CM5 Chip via Protein A can bind Human IGSF11, His Tag with an affinity constant of 14.44 uM as determined in SPR assay (Biacore T200).
Gene Name :
IGSF11
Gene Alias :
BT-IgSF, CXADRL1, Igsf13, MGC35227, VSIG3
Gene Description :
immunoglobulin superfamily, member 11
Gene Summary :
IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM
Other Designations :
CXADR like 1|V-set and immunoglobulin domain containing 3|brain and testis-specific immunoglobin superfamily protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin A ProteinFormulation
B2M/Beta-2-microglobulin Proteinmedchemexpress
Popular categories:
Integrin alpha 1 beta 1
Death Receptor 4
