Name :
Human SLAMF2 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
SLAMF2 (signaling lymphocytic activation molecule family member2), also known as BLAST1 and CD48, is a GPIanchored glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF2 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region. SLAMF2 is expressed on most lineagecommitted hematopoietic cells but not on hematopoietic stem cells or progenitors. CD48 plays important roles in a variety biological processes including adhesion, pathogen recognition, cellular activation, and cytokine regulation, and emerges as a critical effector molecule in immune responses. CD2, SLAMF4 (also known as 2B4 and CD244), and heparan sulfate function as CD48 ligands. In mice, CD48CD2 interactions promote T cell activation and class switching to IgG2a in B cells. In human, high affinity CD48CD244 interactions can either promote or inhibit NK cell and cytotoxic T cell (CTL) activation. A soluble form of CD48 is detected in the serum of lymphoid leukemia and arthritis patients.
Gene Symbol :
The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 – Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
962
Uniprot Entry :
P09326
Construct Details :
The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 – Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF2-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQK EDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKEL QNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 47.8; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
Calculated PI :
8.44
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 73060
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF2 interacts heterophilically with CD2 and SLAMF4/CD244/2B4 (SKU#FCL0791)
Molecule Class :
GPI-anchored Protein
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; BLAST-1; SLAMF-2; MEM-102
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD48
References :
1. J. Exp. Med. 171: 2115-2130 (1990). 2. J. Exp. Med. 176:1241 (1992). 3. J Immunol. 159 (8): 3910-3920 (1997). 4. J. Clin. Immunol. 17:502 (1997). 5. Cell 121:1109 (2005).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ICOS Protein
IGFBP-3 Protein
Popular categories:
Ubiquitin-Specific Peptidase 46
IL-19
