Human ACVR1C/ALK7 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Name :
Human ACVR1C/ALK7 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. The type I receptors are also referred to as ALKs (Activin receptor-like kinases). ACVR1C (Activin receptor type-1C), also known as ALK7, ActR-IC, and ACVRLK7, is a type I receptor in the TGFβ receptor (TGFBR) family. ACVR1C acts as a type-I receptor to transduce signals of activin and Nodal. ACVR1C is expressed in pancreas, heart, colon, small intestine, ovary and brain. Upon ligand binding, ACVR1C associates with the type II receptor ACVR2A to form a signaling complex that activates AVCR1C through phosphorylation. The activated ACVR1C in turn initiates downstream events by phosphorylation of its effectors to regulate gene expression and affect cellular phenotype. ACVR1C may play an important role in cell differentiation, growth arrest and apoptosis.

Gene Symbol :
ACVR1C; ALK7; ALK-7; ActRIC; ACTR-IC; ACVRLK7; ACVRIC; ACVR-IC

NCBI Gene ID :
130399

Uniprot Entry :
Q8NER5

Construct Details :
The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 – Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as “DTT: -“)

Source :
Human cells stably expressing human ACVR1C-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVF CHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMESTGTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK

M.W. :
Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55

Calculated PI :
6.54

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 41910

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity.

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
ALK7; ALK-7; ActRIC; ACTR-IC; ACVRLK7; ACVRIC; ACVR-IC

Research Area :
Development

Pathway/Disease :
Activin/Nodal Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Oncogene 8:2879 (1993). 2. Science 264:101 (1994). 3. J. Biol. Chem. 271:30603 (1996). 4. J. Clin. Endocrinol. Metab. 89:5523 (2004). 5. Nature. 482:251 (2012).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1 alpha Protein
AIF1 Protein
Popular categories:
TGF- β
MIP-3 alpha/CCL20