Share this post on:

Name :
Human IL1RAP Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
IL1RAP (interleukin-1 receptor accessory protein), also known as IL1R3 (interleukin-1 receptor 3), is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin-1 receptor (IL1R) family. Like other family members, IL1RAP contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RAP is identified as a co-receptor for a high-affinity IL-1 receptor type I (IL1R1) complex that mediates IL1-dependent activation of NF-κB, MAPK and other signaling pathways. IL1RAP is required for transducing the signaling events on the plasma membrane level to downstream activation of IL1-responsive genes. IL1 are pleiotropic cytokines that induce synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress. Alternative splicing of the IL1RAP gene results in 2 transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. The soluble form of IL1RAP contributes to the antagonism of IL-1 action. When present with soluble IL1R2, soluble IL1RAP increases the IL­1 binding affinity y of IL1R2 more than 100­fold. In addition, ILRAP interacts with ST2 on mast cells and Th2 T lymphocytes to create a functional receptor complex for transducing IL33-dependent signaling activity.

Gene Symbol :
The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 – ­Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
3556

Uniprot Entry :
Q9NPH3

Construct Details :
The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 – ­Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human IL1RAP-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).

Calculated PI :
6.93

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 98750

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 – 2.5 µg/ml.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
IL-1RAP; IL1R3; IL-1R3; IL-1R-3; C3orf13; IL-1RAcP

Research Area :
Immunology

Pathway/Disease :
IL1R/TLR Signaling Pathway

Species :
Human

CD Antigen :

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GALNT7 Protein
HER2/CD340 Protein
Popular categories:
Retinoid X Receptor beta
IFN-lambda

Share this post on: