Name :
Human SLAMF4 Protein, ECD (Extracellular Domain), Recombinant
Description :
SLAMF4 (signaling lymphocytic activation molecule family member 4), also known as 2B4 and CD244, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF4 contains 2-4 Ig-like domains in the extracellular region and 4 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF4 interacts with SLAMF2/CD48, while other SLAM family proteins bind homophilically. SLAMF4 is implicated in the regulation of natural killer (NK) and T lymphocyte function. SLAMF4 is expressed on all NK cells, γδ T cells, monocytes, some CD4+ and CD8+ T cells, and some dendritic cells. CD48 mediates SLAMF4+ cell interactions with nearly all hematopoietic cell types. SLAMF4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. Ligation of SLAMF4 with antibodies or CD48 can either directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. SLAMF4 can effectively activate and enhance NK cell–mediated cytotoxicity, secretion of IFN-γ and matrix metalloproteinases (MMPs). The inhibitory effect is associated with the long form of SLAMF4, while the activation is associated with the short form.
Gene Symbol :
The recombinant human SLAMF4 ECD protein is expressed as a 214-amino acid protein consisting of Cys22 – Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 – isoform 2) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.
NCBI Gene ID :
51744
Uniprot Entry :
Q9BZW8
Construct Details :
The recombinant human SLAMF4 ECD protein is expressed as a 214-amino acid protein consisting of Cys22 – Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 – isoform 2) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.
Source :
Human cells stably expressing human SLAMF4 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 24.0; Estimated by SDS-PAGE under reducing condition (kDa): 40-50
Calculated PI :
7.85
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 35325
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 (SKU#FCL0449) in a functional ELISA
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD244; 2B4; h2B4; NAIL; Nmrk; NKR2B4; SLAMF-4
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD244
References :
1. J. Exp. Med. 188 : 2083-2090 (1998). 2. J. Immunol. 151: 60-70. (1993). 3. J. Immunol. 173:174 (2004). 4. J. Immunol. 175 : 2045-2049 (2005).. 5. Blood 107: 3181-3188 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFNAR1 Protein
IL-6 Protein
Popular categories:
TRIM/RBCC Proteins
Cell Adhesion Molecule 4/NECL-4
