Name :
Human SLAMF8 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
SLAMF8 (signaling lymphocytic activation molecule family member 8), also known as BLAME and CD353, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF8 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF8 is expressed in lymph node, spleen, thymus and bone marrow as well as dendritic cells and IFNγ stimulated monocytes. Overexpression of SLAMF8 in bone marrow cells leads to an increase in the peritoneal B1b population of B lymphocytes. SLAMF8 may thus play a role in B-lineage commitment and modulation of signaling through the B-cell receptor (BCR).
Gene Symbol :
The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 – Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
56833
Uniprot Entry :
Q9P0V8
Construct Details :
The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 – Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF8-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLE SGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRR ETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVSTGT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK
M.W. :
Calculated molecular mass (kDa): 49.1; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI :
6.21
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 81985
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Not available
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD353; BLAME; SBBI42
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD353
References :
1. J. Immunol. 166:5675-80 (2001). 2. Nat Rev Immunol 6: 56-66 (2006). 3. Trends Immunol 27: 228-34 (2006). 4. Proc Natl Acad Sci.104:10583-8 (2007).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PODXL Protein
AMPK gamma 1/beta 2/alpha 1 Heterotrimer Protein
Popular categories:
SARS-CoV-2 Trimeric S Protein
Receptor Guanylyl Cyclase Family
