Name :
Human NECL4 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
NECL4 (Nectin-like protein 4), also known as IgSF4C and CADM4 (cell adhesion molecule 4), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily. Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL4 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL4 is expressed in brain, prostate, brain, kidney and some other organs. NECL4 is involved in the cell-cell adhesion with calcium- and magnesium-independent cell-cell adhesion activity. In the brain, NECL4 is expressed at high levels concurrent with synapse formation. Heterophilic interaction with NECL1 and NECL3 has also been identified. IGSF4C may also function as a tumor suppressor that is down-regulated in prostate cancers and gliomas.
Gene Symbol :
The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 – Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
199731
Uniprot Entry :
Q8NFZ8
Construct Details :
The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 – Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human NECL4-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRR VRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRP AATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVL DVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSA DNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYASTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
M.W. :
Calculated molecular mass (kDa): 59.0; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
Calculated PI :
6.11
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 67560
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized NECL4 interact heterophilically with NECL1 (SKU#FCL1052) and NECL3 (SKU#FCL1156). Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CADM4; TSLL2; IGSF4C; Necl-4; synCAM4
Research Area :
Cancer
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. Oncogene 20:5401 (2001). 2. Oncogene 25:1446 (2006). 3. Genomics 87:139 (2006). 4. J. Neurosci. 27:12516 (2007). 5. Nat. Rev. Mol. Cell Biol. 9:603 (2008).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD40L/CD154/TRAP Trimer Protein
IL-17A Protein
Popular categories:
Inter-Alpha-Trypsin Inhibitors (ITI)
Small Ubiquitin Like Modifier 3
