Share this post on:

Name :
Human CD30 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
CD30/TNFRSF8 is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). The ligand for CD30 is CD30L/CD153, a member of the TNF superfamily (TNFSF8). CD30L-CD30 ligation mediates pleiotropic effects, including cell proliferation, activation, differentiation and apoptosis. CD30 is expressed in activated, but not resting, T and B cells. CD30 can regulate proliferation of lymphocytes and may also play an important role in human immunodeficiency virus (HIV) replication. As a regulator of apoptosis, CD30 protein induces cell death or proliferation, depending on the cell type, and has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. CD30 contributes to thymic negative selection by inducing the apoptotic cell death of CD4+CD8+ T cells. In B cells, CD30 ligation promotes cellular proliferation and antibody production. CD30 is overexpressed in various hematological malignancies, including Reed-Sternberg cells in Hodgkin’s disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin’s lymphomas (NHLs). CD30 is also found in leukocytes in patients with chronic inflammatory diseases, including lupus erythematosus, asthma, rheumatoid arthritis and atopic dermatitis.

Gene Symbol :
The recombinant human CD30-Fc fusion is expressed as a 585 amino acid protein consisting of Phe19 – Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
943

Uniprot Entry :
P28908

Construct Details :
The recombinant human CD30-Fc fusion is expressed as a 585 amino acid protein consisting of Phe19 – Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human CD30-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTA CVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTV CEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPD SPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSS RTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGE APASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 63.6; Estimated by SDS-PAGE under reducing condition (kDa): 100-110

Calculated PI :
6.13

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 60830

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies (SKU#MAB1173, #MAB1174, #MAB1176) with high affinity. Blocks CD30 Ligand­-induced IL­6 secretion by human Hodgkin’s lymphoma cells

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD30; Ki-1; TNFRSF8; D1S166E

Research Area :
Cancer

Pathway/Disease :
Immune Response

Species :
Human

CD Antigen :
CD30

References :
1. Cell 68:421 (1992). 2. J. Immunol. 156:1387 (1996). 3. Proc. Natl. Acad. Sci. 93 (24): 14053 (1996). 4. J. Biol. Chem. 271 (22): 12852 (1996). 5. Immunology 118:143 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-2R gamma/CD132 Protein
PPM1A Protein
Popular categories:
MUC-1/CD227
CD6

Share this post on: