Name :
Human CD38 Protein, Fc-fusion, Recombinant
Description :
CD38, also known as ADPribosyl cyclase, is a single-pass type II transmembrane protein. CD38 is expressed in B and T lymphocytes, osteoclasts, and in cardiac, pancreatic, liver and kidney cells. CD38 is a multifunctional ectoenzyme that catalyzes the synthesis and hydrolysis of cyclic ADP-ribose from NAD+ to ADP-ribose. Through its production of cyclic ADPribose, CD38 modulates calcium signaling in many types of cells, including neutrophils and pancreatic β cells. CD38 also functions in cell adhesion signal transduction. CD38 has been used as a prognostic marker in leukemia and a surface marker to identify plasma cells. CD38 also plays a key role in neuropeptide release. It may regulate maternal and social behaviors, thereby contributing to neurodevelopmental disorders. Defects of CD38 are associated with impaired immune responses, metabolic disturbances, and behavioral modifications. CD38 is implicated in human immunodeficiency virus (HIV) infection, leukemias, myelomas, solid tumors, type II diabetes mellitus, and bone metabolism. In addition to immune responses, CD38 may play an equally important role as an intrinsic pulmonary component. CD38 is the main cellular NADase in mammalian tissues to control cellular NAD levels, making CD38 a promising therapeutic target for multiple pathological conditions.
Gene Symbol :
The recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 – Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
952
Uniprot Entry :
P28907
Construct Details :
The recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 – Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human CD38-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQ TVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNP VSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDL CQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
Calculated PI :
6.97
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 82485
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1 (SKU#MAB1135), mouse IgG2a (SKU#MAB1119) and rabbit IgG (SKU#MAB1017) in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose.
Molecule Class :
1-Pass Type II Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD38; T10; ADPRC1; ADPRC-1
Research Area :
Cancer
Pathway/Disease :
Calcium Signaling Pathway
Species :
Human
CD Antigen :
CD38
References :
1. J. Immunol. 144:2811 (1990). 2. J. Biol. Chem. 270:30045 (1995). 3. Nature Med. 7:1209 (2001). 4. Nature. 446 (7131): 41 (2007). 5. Curr. Mol. Med. 4:249 (2004).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Coagulation factor XIII A/F13A Protein
ACVR2B Protein
Popular categories:
Cystatin M
Signal Transduction-related CD Proteins
