Name :
Human OX40 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
OX40, also known as CD134, ACT35, TXGP1L and TNFRSF4, is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). OX40 is regarded as a T cell co-stimulatory molecule that coordinates with other membranebound co-stimulators including CD28, CD40, CD30, CD27, and 41BB/CD137. OX40 is absent on naïve T cells and its expression is induced after engagement of the TCR by antigen presenting cells and co-stimulation by CD40/CD40 ligand and CD28/B7. OX40 was identified as the receptor for OX40 ligand/TNFSF4. OX40/OX40L-mediated signaling is critical for establishing or reactivating long-term T-cell immunity and breaking immune tolerance in malignancies, leading to a reactivation of anti-tumor immunity. Engagement of OX40 on activated T cells with OX40 ligand on dendritic cells promotes T cell survival and proliferation, prolongs the immune response, and enhances the transition from effector to memory T cells. OX40 also regulates cytokine production from T cells, antigen-presenting cells, natural killer cells, and natural killer T cells. Mutations in the OX40 gene are associated with immunodeficiency 16 (IMD16). Blockade of OX40 signaling with antibody or soluble receptor is efficacious in animal models of allergic airway inflammation, graftversushost disease and autoimmune disease. Conversely, stimulating OX40 with an agonistic antibody has shown therapeutic potential for cancer and infectious disease.
Gene Symbol :
OX40; CD134; ACT35; TNFRSF4; IMD16; TXGP1L
NCBI Gene ID :
7293
Uniprot Entry :
P43489
Construct Details :
The recombinant human OX40-Fc fusion is expressed as a 414 amino acid protein consisting of Leu29 – Ala214 region of OX40 (UniProt accession #P43489) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions (see the gel image inserted).
Source :
Human cells stably expressing human OX40/CD134 and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTW CNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPW TNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGP STRPVEVPGGRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK
M.W. :
Calculated molecular mass (kDa): 45.5; Estimated by SDS-PAGE under reducing condition (kDa): ~65
Calculated PI :
8.12
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 57880
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to OX40 ligand and anti-OX40/CD134 monoclonal antibodies (SKU#MAB0103) with high affinity by ELISA (see Technical Data). Blocks OX40 Ligandinduced signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD134; ACT35; TNFRSF4; IMD16; TXGP1L
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD134
References :
1. Eur. J. Immunol. 24:677 (1994). 2. Mol. Cell. Biol. 18:558 (1998) 3. Nat. Med. 7:907 (2001). 4. Immunity 15:445 (2001). 5. J. Exp. Med. 210:1743 (2013).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGFBP-2 Protein
Follistatin-like 1/FSTL1 Protein
Popular categories:
IL-10 Receptor
Betacellulin
