Share this post on:

Name :
Human TGFBR1/ALK5 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. The type I receptors are also referred to as ALKs (Activin receptor-like kinases). TGFBR1 (transforming growth factor β receptor I), also known as ALK5, SKR4, and ACVRLK4, is a type I receptor for TGFβ that functions as a tumor suppressor by inhibiting the cell cycle in the G1 phase. TGFBR1 may play an important role in development. Mice deficient in TGFBR1 die at midgestation with severe defects in vascular development and an absence of circulating red blood cells. Defects in TGFBR1 are the cause of Loeys-Dietz syndrome type 1A (LDS1A), Loeys-Dietz syndrome type 2A (LDS2A), and aortic aneurysm familial thoracic type 5 (AAT5). TGFBR1 is involved in proper lymphatic network development. Mutations in TGFBR1 have been identified in multiple human cancers, such as pancreatic, colorectal, ovarian, and head and neck cancers.

Gene Symbol :

NCBI Gene ID :
7046

Uniprot Entry :
P36897

Construct Details :
The recombinant human TGFBR1-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu34 – Glu125 region of TGFBR1 (UniProt accession #P36897) and a C-terminal Fc fusion from human IgG1, which exists as a dimer/tetramer/octamer under non-reducing condition (see the gel image above, labeled as “DTT: -“).

Source :
Human cells stably expressing human TGFBR1-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSK TGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVESTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 35.6; Estimated by SDS-PAGE under reducing condition (kDa): ~45

Calculated PI :
6.39

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 37900

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized TGFBR1 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
ALK5; AAT5; ESS1; LDS1; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1; TGFBRI; ACVRLK4; TbetaR-I

Research Area :
Development

Pathway/Disease :
TGFβ Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Nature 370:341 (1994). 2. Cell 87:1215 (1996). 3. Nature 383:168 (1996). 4. Cell 96:425 (1999). 5. Mol. Cell 8:671 (2001).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CCL24/Eotaxin-2 Protein
IL-25/IL-17E Protein
Popular categories:
Cholinergic Receptor Muscarinic 1 (CHRM1)
Vascular Cell Adhesion Molecule 1

Share this post on: