Name :
Human MANF protein, recombinant
Description :
MANF (mesencephalic astrocyte-derived neurotrophic factor), also known as ARMET (arginine-rich protein mutated in early stage tumors) and ARP (arginine-rich protein), belongs to the ARMET family. The MANF gene is located on chromosome 3p21.1, a region that is frequently deleted in a variety of solid tumors. MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. MANF protects rat embryonic nigral dopaminergic neurons and restores motor function in a rat model of Parkinson’s disease (PD), a movement disorder with characteristic degeneration of dopaminergic neurons. MANF is also known to inhibit cell proliferation and ER stress-induced cell death. The crystal structure shows that MANF consists of two domains, an amino-terminal saposin-like domain that may interact with lipids or membranes and be responsible for its neurotrophic activity, and a presumably unfolded carboxy-terminal domain that may protect cells against ER stress. MANF has also been identified as one of genes in the heart that can be induced and secreted in response to ER stresses such as ischemia. Circulating MANF may protect cardiac myocytes in an antocrine and paracrine manner. MANF is also upregulated in cerebral ischemia in rats and may have neuroprotective effects against cerebral ischemia. Human MANF is synthesized as a 179 amino acid precursor, which is processed to a mature form of 158 amino acids. Human MANF is 99% and 98% amino acid identical to rat and mouse MANF, respectively.
Gene Symbol :
NCBI Gene ID :
7873
Uniprot Entry :
P55145
Construct Details :
The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 – Leu179 region of MANF and a C-terminal poly-Histidine tag
Source :
Human cells stably expressing MANF and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEK ICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDLST GHHHHHHHH
M.W. :
Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation
Calculated PI :
8.55
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as “S” and “M” stands for markers)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED50 of 0.7 – 2.8 μg/ml
Molecule Class :
Neurotrophic Growth Factor (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
MANF; ARP; ARMET; MGC142148; MGC142150
Research Area :
Neuroscience
Pathway/Disease :
Neurological Development & Degenerative Disease
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
RAB7A Protein
Kallikrein-1 Protein
Popular categories:
BMP-8a
Angiopoietin-4
