Name :
Human PD-L2 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
PD-L2 (programmed death ligand 2), also referred to as B7-DC or CD273, is a single pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. It was originally identified as a homolog of PD-L1. Like PD-L1 and other B7 family members, PD-L2 contains one Ig V-like and one Ig C-like domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. PDL1 and PDL2 share ~41% amino acid sequence identity and have similar functions. PD-L2 is expressed on antigen presenting cells, placental endothelium and medullary thymic epithelial cells, and can be induced by LPS and INF-γ. PD-L2 and PD-L1 are two ligands for PD-1/CD279, a member of the CD28/CTLA4 family receptors that play critical roles in regulating T cell activation and immune tolerance. Interaction with PD-1, which has a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), inhibits T-cell proliferation and cytokine production. PD-L2 is also a dendritic cell molecule with co-stimulatory properties for T cells. The interaction of PD-L2/PD-1 has a 2-6-fold higher affinity than that of B7-H1/PD-1.
Gene Symbol :
The recombinant human PD-L2-Fc fusion is expressed as a 429 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
80380
Uniprot Entry :
Q9BQ51
Construct Details :
The recombinant human PD-L2-Fc fusion is expressed as a 429 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing PD-L2-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHI PQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVS VPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTSTGTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGK
M.W. :
Calculated molecular mass 48.2 kDa; estimated by SDS-PAGE under reducing condition ~60 kDa (probably due to glycosylation)
Calculated PI :
6.60
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its receptor PD-1 (SKU# FCL0763) in a functional ELISA (see Technical Data). Blocks its ligand PD-L1’s (SKU#FCL0781) and PD-L2’s (SKU# FCL0786) binding to its receptor and mediated signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD273; B7-DC; PDL2; PDCD1LG2; B7DC; CD273; PDCD1L2; PDL2
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD273
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CYTL1 Protein
Integrin alpha V beta 3 Protein
Popular categories:
Fc Receptor-like 4
BMP-3B/GDF10
