Name :
Human OSM protein, Fc-fusion, biotinylated, recombinant
Description :
Oncostatin M (OSM) is a member of a cytokine family that includes leukemia-inhibitory factor (LIF), granulocyte colony-stimulating factor (G-CSF), and interleukin 6 (IL-6). The human OSM gene encodes a 252-aa pre-pro-OSM polypeptide with a 25-aa signal peptide and a C-terminal domain that are proteolytically processed to generate the 196-aa mature & active form. OSM is a pleiotropic cytokine that signals through cell surface type I and typ II receptors, which share the similarity to gp130, a signal transducing component of the IL-6, LIF and ciliary neurotrophic factor (CNTF) receptor complexes. OSM plays roles in liver development, hematopoeisis, inflammation, bone formation and destruction, and CNS development. OSM was originally identified by its ability to inhibit the growth of cells from melanoma and other solid tumors. It mediates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Like LIF, IL-6 and G-CSF, OSM has the ability to inhibit the proliferation of murine M1 myeloid leukemic cells and induce their differentiation into macrophage-like cells. OSM is found primarily in activated T-lymphocyte and monocyte contributing to inflammation. OSM also has growth stimulatory activities on normal fibroblasts, sarcoma cells, and human erythroleukemia cell line, TF-1. Both OSM and LIF are expressed in the uterus around the time of implantation and considered as important factors for the development of early embryos. As a closely related cytokine to LIF, OSM mimics the activity of LIF in the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Gene Symbol :
NCBI Gene ID :
5008
Uniprot Entry :
P13725
Construct Details :
The recombinant human OSM-Fc is expressed as a 433-amino acid active form consisting of Ala26 – Arg220 region of (UniProt accession #P13725) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human OSM-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGC VLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAF QRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 48.7; Estimated by SDS-PAGE under reducing condition (kDa): ~55
Calculated PI :
9.22
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 48985
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.2 – 0.5 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecule Class :
Cytokine (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
OSM
Research Area :
Stem Cell
Pathway/Disease :
Cell Growth & Differentiation
Species :
Human
CD Antigen :
References :
1. Proc. Natl. Acad. Sci. 83:9739-9743 (1986) 2. Mol. Cell. Biol. 9: 2847-53 (1989). 3. Proc. Natl. Acad. Sci. 88:8641-5 (1991). 4. J. Clin. Invest. 100: 158-68 (1997).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TetR Protein
TRXR1/TXNRD1 Protein
Popular categories:
ACP5
ADAM28
