Share this post on:

Name :
Human ACVR2B Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death. The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal. Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. ACVR2B (Activin receptor type-2B), also known as ACTR-IIB, is a type-II receptors for Activin and Myostatin. Ligands such as Activin and Myostatin bind to ACVR2B, which then associates with a type I receptor to initiate signal transduction. Human, mouse and rat ACVRIIB share greater than 98% amino acid sequence homology. Recombinant soluble ACVRIIB bind Activin with high affinity, and are potent Activin antagonists. Myostatin, a negative regulator of skeletal muscle growth, binds to ACVR2B effectively, and to a lesser extent, to ACVR2A. Haplotype structure at the ACVR2B gene locus may contribute to interindividual variation in skeletal muscle mass and strength. A heterozygous mutation in ACVR2B is a cause of left-right axis malformation, visceral heterotaxy-4 (HTX4).

Gene Symbol :
ACVR2B; HTX4; ACTRIIB; ActR-IIB; ACVRIIB; ACVR-IIB

NCBI Gene ID :
93

Uniprot Entry :
Q13705

Construct Details :
The recombinant human ACVR2B-Fc fusion protein is expressed as a 344 amino acid protein consisting of Ser19 – Thr134 region of ACVR2B (UniProt accession #Q13705) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image above, labeled as “DTT: -“)

Source :
Human cells stably expressing human ACVR2B-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRN SSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNER FTHLPEAGGPEVTYEPPPTAPTSTGTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 38.9; Estimated by SDS-PAGE under reducing condition (kDa): ~55

Calculated PI :
5.49

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 61850

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized ACVR2B binds Activin or Inhibin in a functional ELISA. Neutralize Activin-induced inhibition of MPC11 cell proliferation and hemoglobin expression in K562 human chronic myelogenous leukemia cells.

Molecule Class :
Serine/Threonine Kinase Receptor

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
HTX4; ACTRIIB; ActR-IIB; ACVRIIB; ACVR-IIB

Research Area :
Development

Pathway/Disease :
Activin/Myostatin Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Blood 83:2163(1994). 2. Mol. Cell. Biol. 16:1066(1996). 3. Nature Genet. 17: 252(1997). 4. Genes Dev. 11: 1812(1997). 5. Am. J. Med. Genet. 82: 70(1999).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PD-L1 Protein
SUMF1 Protein
Popular categories:
CD49c/Integrin alpha-3
FCGR2A/CD32a

Share this post on: