Human HER4 protein (extracellular domain), Fc-fusion, recombinant

Name :
Human HER4 protein (extracellular domain), Fc-fusion, recombinant

Description :
HER4 is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK). Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4). They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity. EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation. HER4 ligands include the neuregulins (NRGs), β-cellulin and heparin-binding EGF-like growth factor (HB-EGF). The ligand binding induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. HER4 and its ligand NRG1 are also implicated in the pathophysiology of schizophrenia.

Gene Symbol :

NCBI Gene ID :
2066 (human)

Uniprot Entry :
Q15303 (human)

Construct Details :
The recombinant human HER4 extracellular or ecto-domain (ECD) is expressed as a 862 amino acid protein consisting of Gln26-Pro651 region of HER4 and a C-terminal Fc from human IgG1, which exists as a dimmerr under non-reducing conditions.

Source :
Human cells stably expressing human HER4-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQ FRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTI HWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDC CHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNF VVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGN LIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLS LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGM VCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTC HGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYP WTGHSTLPQHARTPSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 96.3; Estimated by SDS-PAGE under reducing condition (kDa): 100

Calculated PI :
6.14

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 113170

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
It was reported to inhibit the biological activity of Neuregulin-1 on MCF‑7 human breast cancer cells

Molecule Class :
Receptor Tyrosine Kinase (RTK)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
HER4; ERBB4; HER-4; p180erbB4; p180-erbB4

Research Area :
Cancer

Pathway/Disease :
EGF/PDGF Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Cancer Research 48:4083, 1988

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SMYD3 Protein
ATP5F1A Protein
Popular categories:
RELT TNF Receptor
RIO Kinase 1