Human RSPO1 protein, biotinylated, recombinant

Name :
Human RSPO1 protein, biotinylated, recombinant

Description :
RSPO1 (R-Spondin 1, Roof plate-specific Spondin 1), also known as Cristin 3, is a secreted protein belonging to the R-Spondin (RSPO) family. It shares ~40% amino acid identity with three other RSPO family members, which all contain two cystein-rich, furin-like domains and one thrombospondin type 1 domain. RSPO1 is expressed in early development at the roof plate boundary and is implicated in dorsal neural tube development. Postnatally, RSPO1 is expressed by neuroendocrine cells in the intestine, adrenal gland and pancreas, and by epithelia in kidney and prostate. In humans, rare disruptions of the RSPO1 gene are associated with a recessive syndrome characterized by XX sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. In mice, RSPO1 induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced colitis. RSPO1 acts both in the canonical Wnt/β-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent β-catenin pathway through a receptor pathway that may not use frizzled/LRP receptors. RSPO1 is known as a ligand for frizzled FZD8 and LRP6. However RSPO1 does not directly activate LRP6. It regulates cellular responsiveness to Wnt ligands by modulating the cell-surface levels of the co-receptor LRP6. RSPO1 may negatively regulate the TGFβ signaling pathway. In addition RSPO1 may paly an essential roles in ovary determination.

Gene Symbol :
The recombinant human RPSO1 is expressed as a 264 amino acid protein consisting of Ser21 – Ala263 region of (UniProt accession #Q2MKA7) and a and a C-terminal His-tag. It contains potential sites for N-linked glycosylation.

NCBI Gene ID :
284654

Uniprot Entry :
Q2MKA7

Construct Details :
The recombinant human RPSO1 is expressed as a 264 amino acid protein consisting of Ser21 – Ala263 region of (UniProt accession #Q2MKA7) and a and a C-terminal His-tag. It contains potential sites for N-linked glycosylation.

Source :
Human cells stably expressing human RSPO1 and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDAR NPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWS PWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRE NANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPASTTENLYFQGSTGHHHHHHHH

M.W. :
Calculated molecular mass (kDa): 29.3; Estimated by SDS-PAGE under reducing condition (kDa): ~45

Calculated PI :
9.38

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 18335

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive reporter gene in HEK293 cells

Molecule Class :
Growth Factor (secreted)

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
RSPO1; hRspo1; RSPO; CRISTIN3

Research Area :
Stem Cell

Pathway/Disease :
Wnt/β-catenin Signaling Pathway

Species :
Human

CD Antigen :

References :
1. Nature Genetics. 38: 1304-9 (2206). 2. Nature genetics. 38:1233-4 (2006). 3. Proc Natl Acad Sci. 104: 14700-5 (2007). 4. Science 309: 1256 (2005). 5. Proc Natl Acad Sci. 106: 2331-6 (2009). 6. J. Biol. Chem. 281:13247 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free GDF-5 Protein
S100A14 Protein
Popular categories:
CLEC4B2
Fluorescent-labeled Recombinant Proteins