Name :
Human sFRP1 Protein, Fc-fusion, Biotinylated, Recombinant
Description :
sFRP1 (secreted Frizzled-related protein 1), also known as FRP1 and SARP-2, is the founding member of the sFRP family. sFRP family consists of at least 5 secreted glycoproteins that act as extracellular signaling ligands. Each sFRP contains a signal peptide, a cysteine-rich domain (CRD) that shares 30-50% homology with that of Fz (Frizzled) receptors, and a Cterminal heparinbinding region with weak homology to NTR (Netrin). sFRPs function as soluble modulators of Wnt signaling, which plays a key role in embryonic development, cell differentiation and cell proliferation. sFRPs may counteract Wnt-induced effects at high concentrations and promote them at lower concentrations. sFRPs can bind Wnt proteins and Fz receptors in the extracellular compartment. The interaction between sFRPs and Wnt proteins prevents the latter from binding the Fz receptors. sFRP1 is widely expressed with highest levels in heart and fetal kidney. sFRP1 has diverse activities, from inducing angiogenesis to helping regulate Wnt4 signaling (with sFRP2) in renal organogenesis . sFRP1 decreases intracellular beta-catenin levels and exhibits antiproliferative effects on vascular cells. sFRP1 has been characterized as a tumor suppressor in breast and cervical cancer. SFRP1 is also found in malignant gliomas and may contribute to the development of uterine leiomyomas.
Gene Symbol :
The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 – Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
6422
Uniprot Entry :
Q8N474
Construct Details :
The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 – Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human sFRP1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNK NCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNAT EASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLV LYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
M.W. :
Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
Calculated PI :
8.76
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 72195
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED50 of 0.2 – 0.8 µg/mL
Molecule Class :
Ligand (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
sFRP-1; FRP; FRP1; FrzA; FRP-1; SARP2; SARP-2
Research Area :
Stem Cell
Pathway/Disease :
Wnt/β-catenin Signaling Pathway
Species :
Human
CD Antigen :
References :
1. Proc. Natl. Acad. Sci. 94: 2859 (1997). 2. Proc. Natl. Acad. Sci. 94:6770 (1997). 3. Oncogene 19:4210 (2000). 4. J. Biol. Chem. 282:20523 (2007). 5. Stem Cells. 26: 35-44 (2008).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin C/CST3 Protein
RYK Protein
Popular categories:
Notch family
ALK-4/Activin RIB
