Name :
Human HER4 protein (extracellular domain), recombinant
Description :
HER4 is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK). Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4). They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity. EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation. HER4 ligands include the neuregulins (NRGs), β-cellulin and heparin-binding EGF-like growth factor (HB-EGF). The ligand binding induces a variety of cellular responses including mitogenesis and differentiation. Multiple proteolytic events allow for the release of a cytoplasmic fragment and an extracellular fragment. Mutations in this gene have been associated with cancer. HER4 and its ligand NRG1 are also implicated in the pathophysiology of schizophrenia.
Gene Symbol :
NCBI Gene ID :
2066 (human)
Uniprot Entry :
Q15303 (human)
Construct Details :
The recombinant human HER4 extracellular or ecto-domain (ECD) is expressed as a 637 amino acid protein consisting of Gln26-Pro651 region of HER4 and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions
Source :
Human cells stably expressing HER4 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQ FRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTI HWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDC CHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNF VVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGN LIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLS LLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGM VCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTC HGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYP WTGHSTLPQHARTPSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 71.2; Estimated by SDS-PAGE under reducing condition (kDa): ~80
Calculated PI :
6.20
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 77385
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
It was reported to inhibit the biological activity of Neuregulin-1 on MCF‑7 human breast cancer cells
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
HER4; ERBB4; HER-4; p180erbB4; p180-erbB4
Research Area :
Cancer
Pathway/Disease :
EGF/PDGF Signaling Pathway
Species :
Human
CD Antigen :
References :
1. Cancer Research 48:4083, 1988
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NKp44/NCR2 Protein
IL-2R gamma/CD132 Protein
Popular categories:
Cadherin-19
Ubiquitin-Specific Protease 12
