Name :
Human SLAMF6 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
SLAMF6 (signaling lymphocytic activation molecule family member5), also known as NTB-A and CD352, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF6 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF6 is expressed on the surface of NK, T, and B cells as well as eosinophils. It associates homophilically through weak interactions between the Iglike V-type domains. SLAMF6 functions as an activating co-receptor on NK and T cells. Tyrosine phosphorylation in the membrane proximal ITSM enables specific association with the adaptor molecules, leading to SLAMF6 mediated cytotoxicity of NK cells and the production of IFNγ by NK cells. SLAMF6 may also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.SLAMF6 deficient mice show weakened Th2 responses and elevated levels of neutrophilderived inflammatory mediators. On B cells, SLAMF6 modulates Ig class switching and the balance between tolerance and autoimmunity.
Gene Symbol :
The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 – Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
114836
Uniprot Entry :
Q96DU3
Construct Details :
The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 – Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF6-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSL QLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWE ALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI :
6.30
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 59985
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD352; KALI; NTBA; KALIb; Ly108; NTB-A; SF2000; UNQ6123/PRO20080
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD352
References :
1. J. Exp. Med. 194:235 (2001). 2. Immunogenetics 53:843 (2002). 3. J Biol. Chem. 279: 18662 (2004). 4. Immunity 25:559 (2006). 5. Science 312:1665 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
VEGF164 Protein
MMP-9 Protein
Popular categories:
MMP-12
L1 Cell Adhesion Molecule
