Name :
Human SLAMF7 Protein ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
SLAMF7 (signaling lymphocytic activation molecule family member 7), also known as CS1, CRACC and CD319, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF7 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically through its Ig-like V type domain to induce NK, CTL, and B cell activation. SLAMF7 may play a role in the regulation of B cell proliferation during immune responses. SLAMF7 is also implicated in the activation of NK cell-mediated cytotoxicity. SLAMF7 can exert activating or inhibitory effects on immune cells dependent on the cellular context and the availability of signaling effector/adaptor proteins.
Gene Symbol :
The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 – Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
57823
Uniprot Entry :
Q9NQ25
Construct Details :
The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 – Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF7-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKK NDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAAN ESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 48.0; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
Calculated PI :
7.12
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 68465
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF7 interacts homophilically with SLAMF7 in a functional ELISA
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD319; 19A; CS1; CRACC; FOAP-12; UNQ576/PRO1138
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD319
References :
1. J. Immunol. 167:5517 (2001). 2. Immunogenetics 54:394 (2002). 3. J. Immunol. 179 (7): 4672-8 (2007). 4. Nat. Immunol. 10: 297-305 (2009). 5. Immunol. Rev. 214:22 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Serpin E2 Protein
STIM1 Protein
Popular categories:
CD25/IL-2R alpha
Carbonic Anhydrase 6 (CA-VI)