Share this post on:

Name :
Human SLAMF7 Protein ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Description :
SLAMF7 (signaling lymphocytic activation molecule family member 7), also known as CS1, CRACC and CD319, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF7 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells. It interacts homophilically through its Ig-like V type domain to induce NK, CTL, and B cell activation. SLAMF7 may play a role in the regulation of B cell proliferation during immune responses. SLAMF7 is also implicated in the activation of NK cell-mediated cytotoxicity. SLAMF7 can exert activating or inhibitory effects on immune cells dependent on the cellular context and the availability of signaling effector/adaptor proteins.

Gene Symbol :
The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 – Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

NCBI Gene ID :
57823

Uniprot Entry :
Q9NQ25

Construct Details :
The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 – Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Source :
Human cells stably expressing human SLAMF7-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKK NDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAAN ESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass (kDa): 48.0; Estimated by SDS-PAGE under reducing condition (kDa): 60-70

Calculated PI :
7.12

Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 68465

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: “+”)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Immobilized SLAMF7 interacts homophilically with SLAMF7 in a functional ELISA

Molecule Class :
1-pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD319; 19A; CS1; CRACC; FOAP-12; UNQ576/PRO1138

Research Area :
Immunology

Pathway/Disease :
Cell Adhesion

Species :
Human

CD Antigen :
CD319

References :
1. J. Immunol. 167:5517 (2001). 2. Immunogenetics 54:394 (2002). 3. J. Immunol. 179 (7): 4672-8 (2007). 4. Nat. Immunol. 10: 297-305 (2009). 5. Immunol. Rev. 214:22 (2006).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Serpin E2 Protein
STIM1 Protein
Popular categories:
CD25/IL-2R alpha
Carbonic Anhydrase 6 (CA-VI)

Share this post on: