Name :
Human SLAMF9 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
SLAMF9 (signaling lymphocytic activation molecule family member ), also known as CD2F-10 and CD84-H1, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF9 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region but lacks ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF9 is predominantly expressed in hematopoietic tissues and immune cells, including monocytes, dendritic, B- and T-cells as well as leukocyte cell line THP-1. SLAMF9 may play a role in the immune response.
Gene Symbol :
The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 – Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
89886
Uniprot Entry :
Q96A28
Construct Details :
The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 – Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF9-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDP SYSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMD MTYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
M.W. :
Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI :
5.60
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 89560
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti-CD3e antibody induced IL2 secretion by human T cells
Molecule Class :
1-pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD2F10; CD2F-10; CD84H1; CD84-H1; SF2001; CD2F-10; CD84-H1; UNQ1938/PRO4421
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
References :
1. Immunogenetics 53:599 (2001). 2. Clin. Cancer Res. 7:822s (2001). 3. Adv Immunol. 97:177-250 (2008). 4. Annu. Rev. Immunol. 29:665 (2011).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD26/Dipeptidyl Peptidase 4 Protein
COMMD8 Protein
Popular categories:
IL-1R
PVR/CD155