Name :
Human RSPO1 protein, Fc-fusion, recombinant
Description :
RSPO1 (R-Spondin 1, Roof plate-specific Spondin 1), also known as Cristin 3, is a secreted protein belonging to the R-Spondin (RSPO) family. It shares ~40% amino acid identity with three other RSPO family members, which all contain two cystein-rich, furin-like domains and one thrombospondin type 1 domain. RSPO1 is expressed in early development at the roof plate boundary and is implicated in dorsal neural tube development. Postnatally, RSPO1 is expressed by neuroendocrine cells in the intestine, adrenal gland and pancreas, and by epithelia in kidney and prostate. In humans, rare disruptions of the RSPO1 gene are associated with a recessive syndrome characterized by XX sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. In mice, RSPO1 induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced colitis. RSPO1 acts both in the canonical Wnt/β-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent β-catenin pathway through a receptor pathway that may not use frizzled/LRP receptors. RSPO1 is known as a ligand for frizzled FZD8 and LRP6. However RSPO1 does not directly activate LRP6. It regulates cellular responsiveness to Wnt ligands by modulating the cell-surface levels of the co-receptor LRP6. RSPO1 may negatively regulate the TGFβ signaling pathway. In addition RSPO1 may paly an essential roles in ovary determination.
Gene Symbol :
The recombinant human RPSO1-Fc fusion is expressed as a 481 amino acid protein consisting of Ser21 – Ala263 region of (UniProt accession #Q2MKA7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
284654
Uniprot Entry :
Q2MKA7
Construct Details :
The recombinant human RPSO1-Fc fusion is expressed as a 481 amino acid protein consisting of Ser21 – Ala263 region of (UniProt accession #Q2MKA7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human RSPO1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIK CKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGS EERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQ QQQGTVGPLTSAGPASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 53.5; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
Calculated PI :
9.05
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 54120
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 50 – 200 ng/ml.
Molecule Class :
Growth Factor (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
hRspo1; RSPO; CRISTIN3
Research Area :
Stem Cell
Pathway/Disease :
Wnt/β-catenin Signaling Pathway
Species :
Human
CD Antigen :
References :
1. Nature Genetics. 38: 1304-9 (2206). 2. Nature genetics. 38:1233-4 (2006). 3. Proc Natl Acad Sci. 104: 14700-5 (2007). 4. Science 309: 1256 (2005). 5. Proc Natl Acad Sci. 106: 2331-6 (2009). 6. J. Biol. Chem. 281:13247 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-5 Protein
GAP43 Protein
Popular categories:
Viral Proteins
Ubiquitin-Specific Peptidase 16
