Name :
Human CD28 protein, ECD (extracellular domain), Fc-fusion, recombinant
Description :
CD28 is a single-pass type I transmembrane glycoprotein that belongs to the CD28/CTLA4 (cytotoxic T lymphocyte-associated antigen 4, also known as CD152) family of the immunoglobulin (Ig) superfamily. CD28 and CTLA-4 are structurally homologous molecules and both contain one Ig-like V-type domain in the extracellular region. CD28 and CTLA4 are expressed on the cell surface as disulfidelinked homodimers or as monomers. Together with their ligands, CD80 and CD86, they constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses. CD28 is expressed in T-cells and plasma cells, but not in less mature B-cells. CD28 is involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. CD28 is expressed constitutively on nearly all mouse T cells and surface expression is downregulated upon ligation of CD28. CTLA4 is not constitutively expressed but is upregulated rapidly following T cell activation and CD28 ligation. The binding of CD80 and CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CD28 ligation has also been shown to regulate Th1/Th2 differentiation. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. The CD80/CD86/CD28/CTLA4 pathway can positively and negatively regulate immune responses. CD28 is thus regarded as a promising therapeutic target for autoimmune diseases and cancer.
Gene Symbol :
The recombinant human CD28-Fc fusion is expressed as a 362-amino acid protein consisting of Asn19 – Pro152 region of CD28 (UniProt accession #P10747) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
940
Uniprot Entry :
P10747
Construct Details :
The recombinant human CD28-Fc fusion is expressed as a 362-amino acid protein consisting of Asn19 – Pro152 region of CD28 (UniProt accession #P10747) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing CD28-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFY LQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 40.7 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation
Calculated PI :
8.19
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to human B7 family ligands, CD80/B7-1 (SKU#: FCL0716 and FCL0723) and CD86/B7-2 (SKU#: FCL0718 & FCL0725) as well as anti-CD28 monoclonal antibody, human IgG1 (SKU#MAB1827) with high affinity (KD
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD28; TP44; TP-44
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD28
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B3GAT1 Protein
CD40 Protein
Popular categories:
Carboxypeptidase A2
M-CSF R/CD115
