Name :
Human B7-H5 protein, ECD (extracellular domain), Fc-fusion, recombinant
Description :
B7-H5 (B7 homolog 5), also known as platelet receptor Gi24, C10orf54, Dies1, VISTA, PD-1H and SISP1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Unlike other B7 family members that usually contain one Ig V-like and one Ig C-like domain in the extracellular region, mature B7-H5 has only one Ig V- like domain. B7-H5 is expressed in bone, on embryonic stem cells (ESCs), and on tumor cell surfaces. On ESCs, it interacts with BMP-4 and potentiates BMP signaling and the transition from an undifferentiated to a differentiated state. On tumor cells, B7-H5 both promotes MT1-MMP expression and activity and serves as a substrate for MT1-MMP. This increases the potential for cell motility. B7-H5 can be shed by MT1MMP, generating a soluble 30 kDa extracellular fragment and a 25-30 kDa membrane-bound fragment. B7-H5 is expressed on the surface of naïve CD4+ T cells and regulatory T cells. Its expression is upregulated in vivo on activated monocytes and dendritic cells. It is reported that B7-H5 inhibits CD4+ and CD8+ T cell proliferation, and their production of IL2 and IFNγ. Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression. In contrast, it has also been reported that B7-H5 limits disease progression in the autoimmune disease model EAE.
Gene Symbol :
The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 – Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
64115
Uniprot Entry :
Q9H7M9
Construct Details :
The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 – Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing B7-H5-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQ AANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNC VVYPSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 43.7 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
Calculated PI :
6.91
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Inhibits antiCD3e antibody induced IL2 secretion in human T cells.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
B7H5; Gi24; Sisp-1; SISP1;C10orf54; VISTA; Dies1; PD-1H; PP2135; UNQ730/PRO1412
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cyclophilin B/PPIB Protein
Galectin-1/LGALS1 Protein
Popular categories:
BCMA/CD269
Ubiquitin-Conjugating Enzyme E2 D3