Name :
Human CD19 Protein, ECD (Extracellular Domain), Recombinant
Description :
CD19 is a single-pass type I transmembrane protein belonging to the immunoglobulin (Ig) superfamily (IgSF). It contains two Ig-like C2-type domains. CD19 is an important pan B cell marker and co-stimulatory protein involved in growth regulation of B cells. CD19 is expressed only in B cells and follicular dendritic cells of the hematopoietic system. It is present on most pre-B cells and most non-T-cell acute lymphocytic leukemia cells (ALL) and B-cell type chronic lymphocytic leukemia cells (CLL). CD19 is a co-receptor for the antigen receptor complex on B cells to decrease the threshold for antigen receptor-dependent stimulation. It forms a complex with CD21, CD81 and CD225 in the membrane of B cells. It associates with GRB2 and SOS when activated and phosphorylated on Tyr-348 / Tyr-378. CD19 is a hallmark differentiation antigen of the B cell lineage and positively regulates antigen B-cell receptor (BCR) signal transduction for B cell selection, maturation, and differentiation. Defects in CD19 are the cause of immunodeficiency common variable type 3 (CVID3), which is characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of antibody while the numbers of circulating B cells is usually in the normal range, but can be low.
Gene Symbol :
NCBI Gene ID :
930
Uniprot Entry :
P15391
Construct Details :
The recombinant human CD19 ECD is expressed as a 271 amino acid protein consisting of Pro20 – Val279 region of CD19 (UniProt accession #P15391) and a C-terminal His-tag. It contains 5 potential sites for N-linked glycosylation.
Source :
Human cells stably expressing human CD19 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLC QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLP PRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATA QDAGKYYCHRGNLTMSFHLEITARPVSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 29.9; Estimated by SDS-PAGE under reducing condition (kDa): ~45 probably due to glycosylation
Calculated PI :
7.03
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 61355
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “S” and “M” for marker)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds anti-CD19 monoclonal antibody human IgG1 (SKU#0776) with high affinity (KD
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD19; B4; CVID3; Leu-12
Research Area :
Immunology
Pathway/Disease :
B Cell Development
Species :
Human
CD Antigen :
CD19
References :
1. J. Exp. Med. 168:1205-1210 (1988) 2. J. Immunol. 143:712-717 (1989) 3. J Immunol. 158:4662-9 (1997). 4. Leuk Lymphoma. 43:613-6 (2002) 5. N. Engl. J. Med. 354:1901-1912 (2006)
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TFF3 Protein
CD150/SLAMF1 Protein
Popular categories:
CD99/MIC2
Ovarian Tumour Domain Family DUBs
