Share this post on:

Name :
Human CD80 Protein, ECD (extracellular domain), Fc-fusion, Recombinant

Description :
CD80, also known as the B-cell activation antigen B7-1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Like other B7 family members, CD80 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD80 is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. CD80 provides a co-stimulatory signal necessary for T cell activation and survival. CD80 is the ligand for two different receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD80 works in concert with CD86 (also known as B7-2) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL. The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD80 also binds to B7 family ligand PD-L1 to regulate immune cell activation. CD80 may act as a receptor for adenovirus subgroup B and play a role in lupus neuropathy. CD80 is regarded as a promising therapeutic target for autoimmune diseases and cancer. Human CD80 and CD86 share 26% amino acid identity, while human and mouse CD80 share 44% amino acid identity. It has been reported that both human and mouse CD80 and CD86 can bind to either human or mouse CD28 and CTLA4. Human CD80 also interacts with human and mouse PD-L1/B7-H1.

Gene Symbol :
The recombinant human CD80-Fc fusion protein is expressed as a 437amino acid protein consisting of Val35 – Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
941

Uniprot Entry :
P33681

Construct Details :
The recombinant human CD80-Fc fusion protein is expressed as a 437amino acid protein consisting of Val35 – Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing CD80-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALR PSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass 49.5 kDa; estimated by SDS-PAGE under reducing condition 70-75 kDa probably due to glycosylation

Calculated PI :
6.00

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free).

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds human CD28, CTLA4 and PD-L1 (SKU#FCL0781B) by ELISA using immobilized CD80 protein (see Technical Data). Induces IL-2 secretion by Jurkat human acute T cell leukemia cells with an ED50 of 0.05 – 0.2 µg/mL in the presence of PHA.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
B7-1; B7.1; BB1; BB-1; B7; CD28LG; CD28LG1; LAB7

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD80

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-4 Protein
Serpin A3N Protein
Popular categories:
DC-SIGN/CD209
I-TAC/CXCL11

Share this post on: