Name :
Human Tie1 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
Tie1 (Tyrosine kinase with Ig and EGF homology domains 1) and Tie2 comprise a receptor tyrosine kinase (RTK) subfamily with unique structural features: two immunoglobulinlike (Ig) domains flanking three epidermal growth factor (EGF)like domains and followed by three fibronectin type IIIlike repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. Tie1 and Tie2 are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis, and hematopoiesis. Tie2 is a receptor for the angiopoietin (ANG) family: ANG1, ANG2, and ANG3 (mouse)/ANG4 (human). Tie1 may also act as an ANG receptor, possibly in complex with Tie2. Tie1 is an angiopoietin receptor and is an orphan RTK expressed almost exclusively in endothelial cells and required for normal embryonic vascular development. Tie-1 kinase has little to no activity. Tie1 plays an important role in the differentiation of endothelial cells and the maintenance of integrity of the endothelium. Tie1 may inhibit angiopoietin 1 signaling through the endothelial receptor tyrosine kinase Tie2 and ectodomain cleavage of the Tie1 relieves inhibition of Tie2. Tie1 is expressed in epithelial tumours in breast, thyroid and gastric cancers. In addition Tie-1 has a pro-inflammatory property and may play a role in the endothelial inflammatory diseases such as atherosclerosis.
Gene Symbol :
NCBI Gene ID :
7075
Uniprot Entry :
P35590
Construct Details :
The recombinant human Tie1-Fc fusion is expressed as a 967 amino acid protein consisting of Ala22 – Gln759 region of Tie1 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions (see the gel image above).
Source :
Human cells stably expressing human Tie1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
AVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLAR NGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAV LSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLG SAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFG QSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGT CDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIEL RKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPV PLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNL RPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPL VPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPA SPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLW IDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAA EEGLDQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 105.5; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
Calculated PI :
6.64
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 143540
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT:+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Interacts with Tie2 and inhibits angiopoietin/Tie2-mediated signaling activity.
Molecule Class :
Receptor Tyrosine Kinase (RTK)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
Tie1; TIE; JTK14
Research Area :
Cancer
Pathway/Disease :
Angiopoietin Signaling Pathway
Species :
Human
CD Antigen :
References :
1. Mol. Cell. Biol. 12:1698 (1992) 2. Nature. 376: 70 (1995). 3. Mol. Cell 37:643 (2010). 4. Mol. Cell. Biol. 22: 1704 (2002). 5. J. Cell Biol. 169:239 (2005)
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Protein
TIGIT Protein
Popular categories:
Serpin B9
Dengue Virus Proteins
