Name :
Human CD80 Protein, ECD (extracellular domain), Fc-fusion, Biotinylated, Recombinant
Description :
CD80, also known as the B-cell activation antigen B7-1, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily. Like other B7 family members, CD80 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD80 is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. CD80 provides a co-stimulatory signal necessary for T cell activation and survival. CD80 is the ligand for two different receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD80 works in concert with CD86 (also known as B7-2) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL. The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD80 also binds to B7 family ligand PD-L1 to regulate immune cell activation. CD80 may act as a receptor for adenovirus subgroup B and play a role in lupus neuropathy. CD80 is regarded as a promising therapeutic target for autoimmune diseases and cancer. Human CD80 and CD86 share 26% amino acid identity, while human and mouse CD80 share 44% amino acid identity. It has been reported that both human and mouse CD80 and CD86 can bind to either human or mouse CD28 and CTLA4.
Gene Symbol :
The recombinant human CD80-Fc fusion protein is expressed as a 437amino acid protein consisting of Val35 – Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
941
Uniprot Entry :
P33681
Construct Details :
The recombinant human CD80-Fc fusion protein is expressed as a 437amino acid protein consisting of Val35 – Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing CD80-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALR PSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 49.5 kDa; estimated by SDS-PAGE under reducing condition 70-75 kDa probably due to glycosylation
Calculated PI :
6.00
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to human CD28, CTLA4 and PD-L1 by ELISA using immobilized CD80 protein. Binds to human and mouse PD-L1 (SKU#FCL0781, FCL1846) in a functional ELISA (see Technical Data). Induces IL-2 secretion by Jurkat human acute T cell leukemia cells with an ED50 of 0.05 – 0.2 µg/mL in the presence of PHA.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
B7-1; B7.1; BB1; BB-1; B7; CD28LG; CD28LG1; LAB7
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD80
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-gamma R1/CD119 Protein
EphB2 Protein
Popular categories:
CG-alpha
Meconium Antigen 100/CEACAM5
