Name :
Human B7-H4 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
B7H4 (B7 homolog 4), also known as B7X, B7H4, B7S1, and VTCN1, is a single pass type I transmembrane glycoprotein that belongs to the B7 family of the Immunoglobulin (Ig) superfamily. Like other B7 family members, B7-H4 contains one Ig V-like and one Ig C-like domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. B7H4 is expressed on the surface of activated lymphocytes, macrophages, monocytes, dendritic cells, epithelial cells, and bone marrowderived mesenchymal stem cells. It can be up-regulated by IL6 and IL10 and inhibited by CSF2 / GM-CSF and IL4 / interleukin-4 on antigen-presenting cells. B7-H4 negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, B7-H4 plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. B7H4 is also involved in promoting epithelial cell transformation. B7-H4 is up-regulated in several carcinomas in correlation with tumor progression and metastasis. A soluble form of B7H4 is elevated in the serum of ovarian cancer, renal cell carcinoma, and rheumatoid arthritis patients, also in correlation with advanced disease status.
Gene Symbol :
The recombinant human B7-H4-Fc fusion protein is expressed as a 472 amino acid protein consisting of Leu25 – Ser259 region of B7-H4 (UniProt accession #Q7Z7D3) and a C-terminal His-tag. It contains 3 potential sites for N-linked glycosylation.
NCBI Gene ID :
79679
Uniprot Entry :
Q7Z7D3
Construct Details :
The recombinant human B7-H4-Fc fusion protein is expressed as a 472 amino acid protein consisting of Leu25 – Ser259 region of B7-H4 (UniProt accession #Q7Z7D3) and a C-terminal His-tag. It contains 3 potential sites for N-linked glycosylation.
Source :
Human cells stably expressing B7-H4-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMF RGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEA PRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTES EIKRRSHLQLLNSKASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 52.4 kDa; estimated by SDS-PAGE under reducing condition 65-75 kDa probably due to glycosylation
Calculated PI :
5.78
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Inhibits anti-CD3 antibody induced IL2 secretion in human T cells with an ED50 of 0.5 – 2.5 μg/ml
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
VTCN1; B7H4; B7x; B7S1; B7h.5; PRO1291; UNQ659/PRO1291
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGF-I/IGF-1 Protein
Amphiregulin Protein
Popular categories:
CD158z/KIR3DL3
Estrogen Receptor
