Name :
Human B7-H3 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
B7H3 (B7 homolog 3), also known as CD276, is a single pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Like other B7 family members, B7-H3 contains one Ig V-like and one Ig C-like domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. B7-H3 serves as an accessory modulator of T-cell response. It has been reported that B7-H3 can provide both a stimulatory and inhibitory signal to T cells. As a negative regulator, it preferentially affects Th1 responses. B7-H3 may also play an important role in muscle-immune interactions. A longer form of B7-H3 has been identified in human but not in mouse. It is termed 4IgB7H3 or B7H3b with two additional Iglike domains (one V-type and one C-type). B7-H3b appears to be the dominantly expressed form in human and is found on human dendritic cells, activated T, B and NK cells. Human B7H3b binding to an undefined receptor may inhibit NK cell killing and cytokine release. It is also involved in late stage osteoblast differentiation. B7-H3 is detected in a variety of cancer types and its expression in some cancers correlates with poor outcome of cancer patients.
Gene Symbol :
The recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 – Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 – isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
80381
Uniprot Entry :
Q5ZPR3
Construct Details :
The recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 – Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 – isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing B7-H3-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
M.W. :
Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
Calculated PI :
5.53
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Inhibits antiCD3induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 (SKU#MAB1755) and rabbit IgG (SKUMAB1753) in a functional ELISA (see Technical Data).
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD276; B7H3; B7RP-2; 4Ig-B7-H3; PSEC0249; UNQ309/PRO352
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD276
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HDAC8 Protein
VEGFR-3/FLT4 Protein
Popular categories:
Ebola Virus GP2
Siglec-3/CD33
