Name :
Human B7-H6 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
B7H6 (B7 homolog 6), also known as NCR3LG1 (Natural cytotoxicity triggering receptor 3 ligand 1), is a single pass, type I transmembrane glycoprotein that belongs to the B7 family of the Immunoglobulin (Ig) superfamily. Among the family members, they share about 20-25% amino acid (aa) identity. Like other B7 family members, B7-H6 contains one Ig V-like and one Ig C-like domain in the extracellular region. Within the ECD, human B7H6 shares 99% aa identity with chimpanzee B7-H6 and 53% - 56% with bovine, canine, and equine B7-H6. Orthologs in rodents have not been identified. The Ig V-like domain of B7-H6 mediates the interaction with NKp30 (also known as NCR3 and CD337) expressed on NK cells, resulting in natural killer (NK) cell activation and cytotoxicity. B7-H6 does not show binding to other natural killer cell-activating receptors, such as NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7H6 induces NK cell activation and target cell cytolysis. B7-H6 is expressed on a wide range of tumor cells, including T and B-lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells, The B7-H6 expression is consistent with the detection of NKp30 binding sites on these tumor cells and correlates with tumor cell sensitivity to NKp30-dependent cell lysis.
Gene Symbol :
The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 – Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
374383
Uniprot Entry :
Q68D85
Construct Details :
The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 – Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing B7-H6-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRP GAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENE DKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTV YQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSSTGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 52.2 kDa; estimated by SDS-PAGE under reducing condition 75-85 kDa probably due to glycosylation
Calculated PI :
5.80
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its receptor NKp30/NCR3 and Induces IFN-γ secretion by NK-92 human natural killer lymphoma cells with an ED50 of 0.4 – 2.6 µg/ml.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
B7-H6; B7H6; NCR3LG1; DKFZp686O24166
Research Area :
Immunology
Pathway/Disease :
NK Cell Receptor Pathway
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TGFBR1/ALK-5 Protein
Integrin beta-1/CD29 Protein
Popular categories:
Ubiquitin-Specific Protease 9
MCP-2 Protein/CCL8
