Share this post on:

Name :
Human B7-H6 Protein, ECD, Fc-fusion, Biotinylated, Recombinant

Description :
B7­H6 (B7 homolog 6), also known as NCR3LG1 (Natural cytotoxicity triggering receptor 3 ligand 1), is a single pass, type I transmembrane glycoprotein that belongs to the B7 family of the Immunoglobulin (Ig) superfamily. Among the family members, they share about 20-25% amino acid (aa) identity. Like other B7 family members, B7-H6 contains one Ig V-like and one Ig C-like domain in the extracellular region. Within the ECD, human B7­H6 shares 99% aa identity with chimpanzee B7­-H6 and 53% -­ 56% with bovine, canine, and equine B7­-H6. Orthologs in rodents have not been identified. The Ig­ V-like domain of B7-H6 mediates the interaction with NKp30 (also known as NCR3 and CD337) expressed on NK cells, resulting in natural killer (NK) cell activation and cytotoxicity. B7-H6 does not show binding to other natural killer cell-activating receptors, such as NKp44, NKp46, or NKG2D. Ligation of NKp30 by B7­H6 induces NK cell activation and target cell cytolysis. B7-­H6 is expressed on a wide range of tumor cells, including T and B-lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells, The B7-H6 expression is consistent with the detection of NKp30 binding sites on these tumor cells and correlates with tumor cell sensitivity to NKp30-dependent cell lysis.

Gene Symbol :
The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 – Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
374383

Uniprot Entry :
Q68D85

Construct Details :
The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 – Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing B7-H6-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRP GAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENE DKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTV YQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSSTGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass 52.2 kDa; estimated by SDS-PAGE under reducing condition 75-85 kDa probably due to glycosylation

Calculated PI :
5.80

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds to its receptor NKp30/NCR3 and Induces IFN-γ secretion by NK-92 human natural killer lymphoma cells with an ED50 of 0.4 – 2.6 µg/ml.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
B7-H6; B7H6; NCR3LG1; DKFZp686O24166

Research Area :
Immunology

Pathway/Disease :
NK Cell Receptor Pathway

Species :
Human

CD Antigen :

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TGFBR1/ALK-5 Protein
Integrin beta-1/CD29 Protein
Popular categories:
Ubiquitin-Specific Protease 9
MCP-2 Protein/CCL8

Share this post on: