Share this post on:

Name :
Human B7-H5 Protein ECD, Fc-fusion, Biotinylated, Recombinant

Description :
B7-H5 (B7 homolog 5), also known as platelet receptor Gi24, C10orf54, Dies1, VISTA, PD-1H and SISP1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Unlike other B7 family members that usually contain one Ig V-like and one Ig C-like domain in the extracellular region, mature B7-H5 has only one Ig V- like domain. B7-H5 is expressed in bone, on embryonic stem cells (ESCs), and on tumor cell surfaces. On ESCs, it interacts with BMP-4 and potentiates BMP signaling and the transition from an undifferentiated to a differentiated state. On tumor cells, B7-H5 both promotes MT1-MMP expression and activity and serves as a substrate for MT1-MMP. This increases the potential for cell motility. B7-H5 can be shed by MT1­MMP, generating a soluble 30 kDa extracellular fragment and a 25-30 kDa membrane-bound fragment. B7-H5 is expressed on the surface of naïve CD4+ T cells and regulatory T cells. Its expression is up­regulated in vivo on activated monocytes and dendritic cells. It is reported that B7-H5 inhibits CD4+ and CD8+ T cell proliferation, and their production of IL­2 and IFN­γ. Its expression on tumor cells attenuates the anti­tumor immune response and enables more rapid tumor progression. In contrast, it has also been reported that B7-H5 limits disease progression in the autoimmune disease model EAE.

Gene Symbol :
The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 – Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
64115

Uniprot Entry :
Q9H7M9

Construct Details :
The recombinant human B7-H5-Fc fusion protein is expressed as a 390 amino acid protein consisting of Phe33 – Ala194 region of B7-H5 (UniProt accession #Q9H7M9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing B7-H5-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQ AANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNC VVYPSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK

M.W. :
Calculated molecular mass 43.7 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation

Calculated PI :
6.91

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Inhibits anti­CD3e antibody induced IL­2 secretion in human T cells.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
B7H5; Gi24; Sisp-1; SISP1;C10orf54; VISTA; Dies1; PD-1H; PP2135; UNQ730/PRO1412

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-7 Protein
FCRN-B2M Protein
Popular categories:
TrkA
Growth Differentiation Factor 9 (GDF-9)

Share this post on: