Name :
Human TIM-3 Protein, ECD, Fc-fusion, Biotinylated, Recombinant
Description :
TIM3 (T cell immunoglobulin and mucin domain3), also known as HAVCR2, is a single-pass type I transmembrane glycoprotein of the TIM family of Ig superfamily. Like other family members, TIM-3 contains one Iglike Vtype domain and a Ser/Thrrich mucin stalk domain in the extracellular region. An alternatively spliced isoform is truncated within the mucinlike stalk. TIM-3 is selectively expressed on Th1 (T-helper type 1) cells but not on Th2 cells. Th1 cells produce cytokines (IFN-γ, interleukin-2, TNF-α and lymphotoxin) associated with cell-mediated immune responses against intracellular pathogens, delayed-type hypersensitivity, and induction of organ-specific autoimmunity. TIM3 is upregulated on activated myeloid cells and T cells. TIM-3 regulates macrophage activation and inhibits Th1-mediated auto- and allo-immune responses to promote immunological tolerance. It may be also involved in T-cell homing. Galectin9 has been identified as a ligand for TIM-3. The binding of Galectin-9 to TM-3 enhances immune tolerance and inhibits antitumor immunity. It can alternatively trigger immune stimulatory effects, such as the co-activation of NK cell cytotoxicity. TIM3 dampens inflammation by enabling the phagocytosis of apoptotic cells and the crosspresentation of apoptotic cell antigens. Dysregulation of the Galectin-9/TIM-3 pathway is implicated in many chronic autoimmune conditions in human, such as multiple sclerosis and systemic lupus erythematosus.
Gene Symbol :
The recombinant human TIM-3-Fc fusion protein is expressed as a 409 amino acid protein consisting of Ser22 – Gly202 region of TIM-3 (UniProt accession #Q8TDQ0) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
NCBI Gene ID :
84868
Uniprot Entry :
Q8TDQ0
Construct Details :
The recombinant human TIM-3-Fc fusion protein is expressed as a 409 amino acid protein consisting of Ser22 – Gly202 region of TIM-3 (UniProt accession #Q8TDQ0) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing human TIM-3-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIE NVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQ ISTLANELRDSRLANDLRDSGATIRIGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 45.6; Estimated by SDS-PAGE under reducing condition (kDa): ~65 (probably due to glycosylation).
Calculated PI :
7.04
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 61600
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds its ligand Galectin-9 and blocks Galectin-9/TIM-3 mediated signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
TIM-3; TIM3; TIMD3; TIMD-3; KIM-3; HAVCR2; HAVCR-2
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HVEM/TNFRSF14 Protein
LILRB4/CD85k/ILT3 Protein
Popular categories:
NEK7
LIR-1
