Name :
Human B7-H7 Protein, ECD, Fc-fusion, biotinylated, recombinant
Description :
B7-H7 (B7 homolog 7), also known as HHLA2 (human endogenous retrovirus-H long terminal repeat-associating protein 2), is regarded as a new member of the B7 ligand family. B7-H7 contains 1 Ig-like (immunoglobulin-like) C1-type and 2 Ig-like V-type domains while other members are typically composed of 1 Ig-like V-type and 1 Ig-like C1-type domains. Interactions between members of the B7 ligand and CD28/CTLA4 receptor families can generate positive co-stimulation and negative co-inhibition in regulating T cell responses. B7-H7 is expressed at high levels in colon, kidney, testis, lung and pancreas, and at lower levels in small intestine, liver and skeletal muscle. In immune cells, B7-H7 is highly expressed in B-cells, dendritic cells, monocytes and macrophages, but not detected in T-cells. B7-H7 was reported to regulate cell-mediated immunity by binding to a putative receptor on T lymphocytes and inhibiting the proliferation of T cells. B7-H7 has also been referred to as B-H5 (B7 homolog 5), which was identified as a specific ligand for CD28H (CD28 homolog) or TMIGD2 (transmembrane and Ig domain-containing protein 2). B7-H5 is constitutively found in macrophages and could be induced on dendritic cells in response to inflammation. The B7-H5/CD28H interaction was shown to selectively co-stimulate human T-cell growth and cytokine production via an AKT-dependent signalling cascade.
Gene Symbol :
NCBI Gene ID :
11148
Uniprot Entry :
Q9UM44
Construct Details :
The recombinant human B7-H7-Fc fusion protein is expressed as a 574 amino acid protein consisting of Ile23 – Lys345 region of HHLA2/B7-H7 (UniProt accession #Q9UM44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing B7-H7-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYK VHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGV FLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYEC TIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQN TIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGSTGT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQV SLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
M.W. :
Calculated molecular mass 65.0 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation
Calculated PI :
6.04
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Inhibits anti-CD3 antibody induced cytokine (e.g., IFN- and IL-2) secretion in human T lymphocytes
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
HHLA2; B7H7; B7-H5; B7H5
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
KEAP1 Protein
NRG1-beta 1 Protein
Popular categories:
Frizzled-10
CD53
