Share this post on:

Name :
Human PD-L1 protein, ECD (extracellular domain), biotinylated, recombinant

Description :
PD-L1 (programmed cell death 1 ligand 1) or CD274 is a 290-amino acid single pass type I transmembrane protein of the Ig (immunoglobulin) superfamily. It contains one Ig V-like and one Ig C-like domains in the extracellular region, and a 30-amino acid cytoplasmic tail. It was originally cloned as a homolog of B7 (termed B7-H1). It is 20% and 15% identical to B7-1 (CD80) and B7-2 (CD86), respectively. It was also cloned as a ligand (termed PDCD1L1 or PD-L1) that binds to PD-1 (CD279) and B7-1 (CD80), but not to other B7 family members, such as CTLA4 (CD152), CD28, or ICOS (CD278). PD-L1 or CD274 is involved in the T cell costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNγ. Interaction with PD-1, which has a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), inhibits T-cell proliferation and cytokine production. PD-L1 is up-regulated on T- and B-cells, dendritic cells, keratinocytes and monocytes after LPS and IFNγ activation or by surface Ig cross-linking. It is expressed in many types of freshly isolated human cancers but not in most normal tissues. Blockade of PD-L1 upregulates IL12 expression and enhances antitumor immunity in mice bearing ovarian tumors. Therefore, PD-L1 has been proposed as a target for cancer immunotherapy through pre-activated T cells that could be enhanced by blockade of PD-L1-induced inhibitory signaling.

Gene Symbol :

NCBI Gene ID :
29126

Uniprot Entry :
Q9NZQ7

Construct Details :
The recombinant human PD-L1 or CD274 ECD is expressed as a 231 amino acid protein consisting of Phe19 – Arg238 region of CD274 (UniProt accession #Q9NZQ7) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation

Source :
Human cells stably expressing PD-L1 ECD and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVK LQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFN VTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTGHHHHHHHH

M.W. :
Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states

Calculated PI :
6.27

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds to its receptor PD-1 extracellular domain proteins (SKU# FCL0761 and FCL0763) and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody (SKU# MAB0199) with high affinity(KD < 1 nM) as measured by ELISA (see Technical Data).

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
PD-L1; CD274; B7-H1; B7H1; PDL1; PDCD1L1; PDCD1LG1

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD274

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
APEG1 Protein
APRIL/TNFSF13 Protein
Popular categories:
Platelet Factor 4
IFN-lambda 4

Share this post on: