Name :
Human PD-L2 protein (extracellular domain), biotinylated, recombinant
Description :
PD-L2 (programmed death ligand 2), also referred to as B7-DC or CD273, is a single pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. It was originally identified as a homolog of PD-L1. Like PD-L1 and other B7 family members, PD-L2 contains one Ig V-like and one Ig C-like domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. PDL1 and PDL2 share ~41% amino acid sequence identity and have similar functions. PD-L2 is expressed on antigen presenting cells, placental endothelium and medullary thymic epithelial cells, and can be induced by LPS and INF-γ. PD-L2 and PD-L1 are two ligands for PD-1/CD279, a member of the CD28/CTLA4 family receptors that play critical roles in regulating T cell activation and immune tolerance. Interaction with PD-1, which has a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), inhibits T-cell proliferation and cytokine production. PD-L2 is also a dendritic cell molecule with co-stimulatory properties for T cells. The interaction of PD-L2/PD-1 has a 2-6-fold higher affinity than that of B7-H1/PD-1.
Gene Symbol :
The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.
NCBI Gene ID :
80380
Uniprot Entry :
Q9BQ51
Construct Details :
The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 – Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.
Source :
Human cells stably expressing PD-L2 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGK ASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYP LAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQME PRTHPTSTGHHHHHHHH
M.W. :
Calculated molecular mass 24 kDa; estimated by SDS-PAGE under reducing condition ~45 kDa (probably due to glycosylation)
Calculated PI :
6.61
Calculated Extinction Coefficients :
Endotoxin Level :
>90% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to its receptor PD-1 (SKU#: FCL0763 and FCL0761) and induce the receptor-mediated signaling activity.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD273; B7-DC; PDL2; PDCD1LG2; B7DC; CD273; PDCD1L2; PDL2
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD273
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Profilin-2 Protein
CD200 Protein
Popular categories:
VRK Serine/Threonine Kinase 1
Frizzled-8
