Name :
Human SLAMF1 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant
Description :
SLAMF1 (signaling lymphocytic activation molecule family member1), also known as SLAM and CD150, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF1 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 3 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF1 is expressed on lymphocytes, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells. Its expression is upregulated on lymphocytes cells after activation. As a self-ligand, SLAMF1 plays an important role in bidirectional T-cell to B-cell stimulation. It performs diverse immunologic functions including T/B-cell costimulation, induction of interferon-γ in Th1 T-cell clones, redirection of Th2 clones to a Th1 or Th0 phenotype, and inhibition of apoptosis in B cells. SLAMF1 ligation also promotes an allergeninduced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages. In human, SLAMF1 also functions as a cellular entry receptor for measles virus.
Gene Symbol :
The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 – Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
NCBI Gene ID :
6504
Uniprot Entry :
Q13291
Construct Details :
The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 – Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source :
Human cells stably expressing human SLAMF1-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYK FYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAY SWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI :
8.17
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 66070
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT “+”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Co-stimulates IL-4 secretion by T cells in the presence of anti-CD3e antibody
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD150; SLAM; CDw150; IPO-3; SLAMF-1
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD150
References :
1. Nature 376: 260-263 (1995). 2. Nature 406: 893-897 (2000). 3. Nature Immunol. 4: 19-24 (2003). 4. J. Exp. Med. 185:993 (1997). 5. J. Immunol. 158:4036 (1997).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-17RA Protein
FGF-9 Protein
Popular categories:
IgG1
CD42d/Platelet Glycoprotein V
