Name :
Mouse VEGF Protein, Isoform 164, Biotinylated, Recombinant
Description :
VEGF, also known as VEGF-A (vascular endothelial growth factor A) and VPF (vascular permeability factor), is the founding member of the VEGF family, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGFs are secreted polypeptides with a highly conserved receptor-binding cystine-knot structure similar to that of the platelet-derived growth factors (PDGF). VEGF plays important roles in vascular development and in diseases involving abnormal growth of blood vessels such as tumor-related angiogenesis. VEGF is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. It induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and increases permeabilization of blood vessels. VEGF is involved in normal and pathological angiogenesis, a process that is associated with inflammation, wound healing, embryonic development, growth and metastasis of solid tumors. Elevated levels of VEGF have been detected in patients with cancer and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. VEGF is known to bind to the FLT1 (VEGFR1) and KDR (VEGFR2) receptors, heparan sulfate and heparin. Targeting VEGF signaling pathway has shown therapeutic benefits in multiple cancer types. Alternately spliced VEGF isoforms of 120, 164, and 188 amino acids in length exist in mouse. Isoforms other than mVEGF120 contain basic heparinbinding regions and are thus not freely diffusible. Mouse VEGF120 shares 87% sequence identity with human VEGF121.
Gene Symbol :
Mouse VEGF164, also known as VEGF, is expressed as a 175-amino acid protein consisting of the region Ala27 – Arg190 of mouse VEGF (UniProt Accession #Q00731-2, isoform VEGF164) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and exists as a dimer under non-reducing condition (see the gel image inserted).
NCBI Gene ID :
7422 (human), 22339 (mouse)
Uniprot Entry :
P15692 (human), Q00731 (mouse)
Construct Details :
Mouse VEGF164, also known as VEGF, is expressed as a 175-amino acid protein consisting of the region Ala27 – Arg190 of mouse VEGF (UniProt Accession #Q00731-2, isoform VEGF164) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and exists as a dimer under non-reducing condition (see the gel image inserted).
Source :
Mammalian cells stably expressing mouse VEGF164 and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRSTGHHHHHHHH
M.W. :
Calculated molecular mass (kDa): 20.6; Estimated by SDS-PAGE under reducing condition (kDa): ~30 (probably due to glycosylation)
Calculated PI :
7.95
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 6960
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds its receptors (FLT1, KDR) and anti-VEGF monoclonal antobodies (SKU#MAB0345, MAB0337 ) with high affinity (KD
Molecule Class :
Angiogenic Growth Factor (secreted)
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
VEGFA; VEGF-A; VPF; MVCD1
Research Area :
Angiogenesis
Pathway/Disease :
VEGF Signaling Pathway
Species :
Mouse
CD Antigen :
References :
1. Science 246:1306-1309, 1989
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
VEGF-D Protein
Cochlin/COCH Protein
Popular categories:
B7-H3
CD138/Syndecan-1
