Name :
Human CTLA4 Protein, ECD (extracellular domain), Recombinant
Description :
Cytotoxic T-lymphocyte antigen 4 (CTLA4), aslo known as CD152, is a single pass type I transmembrane glycoprotein of the Ig superfamily. It is composed of an IgV-type extracellular domain, a transmembrane domain, and a cytoplasmic tail. CTLA4 is the founding member of the CD28/CTLA-4 family. Members of the CD28/CTLA-4 family either promote T cell activation (CD28 and ICOS) or inhibit T cell activation (CTLA4 and PD1). Both CTLA-4 and CD28 bind to the same B7 family ligands, CD80/B7-1 and CD86/B7-2. CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28. The CTLA4 gene is widely expressed with highest levels in lymphoid tissues. It is detected in activated T-cells where expression levels are 30- to 50-fold less than CD28 on the cell surface following activation. Mutations in CTLA4 gene is associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. Alternate transcriptional splice variants, encoding different isoforms of CTLA4, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. The engineered CTLA4-Fc fusion proteins inhibit T-cell-dependent immune responses and are used as immunosuppressive agents by acting as a competitive inhibitor of CD28. Blockade of CTLA4 inhibitory activity with monoclonal antibodies enhances antitumor immunity and has been proven to be an effective approach for cancer immunotherapy.
Gene Symbol :
NCBI Gene ID :
14931
Uniprot Entry :
P16410
Construct Details :
The recombinant human CTLA4 ECD is expressed as a 138-amino acid protein consisting of Lys36 – Asp161 region of CTLA4 (UniProt accession #Q16410) and a C-terminal His-tag. It contains 2 potential N-linked glycosylation sites.
Source :
Human cells stably expressing CTLA4 ECD and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQ VNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDGSTGHHHHHHHH
M.W. :
Calculated molecular mass 14.9 kDa; estimated by SDS-PAGE under reducing condition ~25 kDa probably due to glycosylation
Calculated PI :
5.76
Calculated Extinction Coefficients :
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free)
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Binds to human B7 family ligands, CD80/B7-1 (SKU#: FCL0716 and FCL0723) and CD86/B7-2 (SKU#: FCL0718 and FCL0725), and anti-CTLA4 monoclonal antibody (SKU#: MAB1718) with high affinity KD
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
CD152; CD; GSE; GRD4; CTLA-4; IDDM12; CELIAC3
Research Area :
Immunology
Pathway/Disease :
T Cell Costimulation
Species :
Human
CD Antigen :
CD152
References :
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Calreticulin/CALR Protein
PTK7 Protein
Popular categories:
PKC-nu
ILT-7
