Name :
Human CD99 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant
Description :
CD99, also known as MIC2, HBA71 and T-cell surface glycoprotein E2, is a single-pass type I transmembrane protein, which is the founding member of the CD99 protein family, including CD99, CD99L2, and XG. Human CD99 contains a 100-aa extracellular domain (ECD) with no identifiable motifs, Nlinked glycosylation sites, or cysteine residues but with potential sites for Olinked glycosylation. The cytoplasmic region, albeit short, has signal transduction capability. CD99 is expressed on most hematopoietic cells, endothelial cells and at the borders between confluent cells. Cells known to express CD99 include fibroblasts, neutrophils, T cells, doublepositive thymocytes, CD34+ stem cells, monocytes and endothelial cells. There are multiple isoforms for human CD99, which appears to activate distinctive signal pathways and mediate different biological outcomes. CD99 may be a receptor for PILR-alpha and -beta, which are found on selected leukocytes. CD99 is involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. Homophilic interaction between CD99 on the neutrophil and on the endothelial cell regulates the transendothelial migration of neutrophils during inflammation. CD99 possesses the ability to rearrange the actin cytoskeleton and may function as an oncosuppressor in osteosarcoma. CD99 is a specific marker for Ewing’s sarcoma, primitive neuroectodermal tumor, and sex cord-stromal tumors. The degree of CD99 reactivity correlates with the degree of differentiation in Sertoli-Leydig cell tumors.
Gene Symbol :
CD99; MIC2; HBA71; MIC2X; MIC2Y; MSK5X; E2; 12E7
NCBI Gene ID :
4267
Uniprot Entry :
P14209
Construct Details :
The recombinant human CD99-Fc is expressed as a 329 amino acid protein consisting of Asp23 – Ala123 region of CD99 (UniProt #P14209 – isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source :
Human cells stably expressing human CD99-Fc and growing in chemical-defined media with no animal components or antibiotics
Amino Acid Sequence: :
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNH PSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADASTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK
M.W. :
Calculated molecular mass (kDa): 35.7; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
Calculated PI :
5.18
Calculated Extinction Coefficients :
(M-1 cm-1, at 280nm): 35785
Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as “DTT: +”)
Formulation :
Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity :
Immobilized CD99-Fc protein supports homophillic interaction with CD99 itself (e.g., via biotinylated CD99 protein) by a functional ELISA.
Molecule Class :
1-Pass Type I Transmembrane
Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Gene Family :
MIC2; HBA71; MIC2X; MIC2Y; MSK5X; E2; 12E7
Research Area :
Immunology
Pathway/Disease :
Cell Adhesion
Species :
Human
CD Antigen :
CD99
References :
1. EMBO J. 8:3253 (1989). 2. Blood 83:415 (1994). 3. J. Immunol. 159:2250 (1997). 4. Nat. Immunol. 3:143 (2002). 5. J. Exp. Med. 199:525 (2004). 6. J. Biol. Chem. 281:34833 (2006).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Carbonic Anhydrase 9 Protein
Fractalkine/CX3CL1 Protein
Popular categories:
Serpin A9
Tyrosine-Protein Kinase CSK
