Share this post on:

Name :
Human B7-H2 Protein, ECD, Fc-fusion, Biotinylated, Recombinant

Description :
B7­H2 (B7 homolog 2), also known as CD275, B7RP1 (B7­related protein) and ICOSL (ICOS Ligand), is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the immunoglobulin (Ig) superfamily. Like other B7 family members, B7-H25 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the family members, they share about 20-25% amino acid identity. B7-H2 is expressed on antigen presenting cells such as B cells, macrophages, monocytes, and dendritic cells. B7-H2 has been identified as the ligand for ICOS (also known as CD278), a member of the CD28/CTLA4 family of co-stimulatory receptors. The receptor binding of B7-H2 is mediated by the IgV domain and requires the IgC domain for maintaining the structural integrity of the protein. The B7-H2/ICOS interaction plays roles in T cell dependent B cell activation and Th (T helper) cell differentiation, leading to both positive and negative effects on immune responses. In human, B7-H2 also binds to CD28 and CTLA4, and its interaction with CD28 can co-stimulate T cells. B7-H2 contributes to the development of allergic asthma and other autoimmune conditions. A soluble form of human B7­H2 is elevated in the circulation of patients with systemic lupus erythematosus. In the thyroid, B7­H2 is up­regulated on thyrocytes during inflammation and promotes the production of thryoid hormones. It is reported that mouse and human B7-H2 show cross­species binding to ICOS.

Gene Symbol :
The recombinant human B7-H2/ICOSL/CD275-Fc fusion protein is expressed as a 466 amino acid protein consisting of Asp19 – Thr256 region of B7-H2 (UniProt accession #O75144) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

NCBI Gene ID :
23308

Uniprot Entry :
O75144

Construct Details :
The recombinant human B7-H2/ICOSL/CD275-Fc fusion protein is expressed as a 466 amino acid protein consisting of Asp19 – Thr256 region of B7-H2 (UniProt accession #O75144) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Source :
Human cells stably expressing B7-H2-Fc and growing in chemical-defined media with no animal components or antibiotics

Amino Acid Sequence: :
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGD FSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWI NKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVST GEKNAATSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK

M.W. :
Calculated molecular mass 52 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation

Calculated PI :
5.63

Calculated Extinction Coefficients :

Endotoxin Level :
>95% judged by SDS-PAGE under reducing condition (see the gel image above)

Formulation :
Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

Endotoxin Level :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Biological Activity :
Binds human ICOS and stimulates human T cell proliferation in the presence of anti-CD3.

Molecule Class :
1-Pass Type I Transmembrane

Gene Synonym :
<0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

Gene Family :
CD275; ICOSL; B7H2; GL50; ICOSLG; B7RP1; ICOS-L; LICOS; B7RP-1; KIAA0653

Research Area :
Immunology

Pathway/Disease :
T Cell Costimulation

Species :
Human

CD Antigen :
CD275

References :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TPM4 Protein
LIFR Protein
Popular categories:
Tissue Inhibitor of Metalloproteinase 4 (TIMP-4)
MUC-1/CD227

Share this post on: